VIAF

Virtual International Authority File

Search

Leader 00000nz a2200037n 45 0
001 WKP|Q79389693 (VIAF cluster) (Authority/Source Record)
003 WKP
005 20241121000211.0
008 241121nneanz||abbn n and d
035 ‎‡a (WKP)Q79389693‏
024 ‎‡a 0000-0003-4408-7809‏ ‎‡2 orcid‏
035 ‎‡a (OCoLC)Q79389693‏
100 0 ‎‡a কেনেথ জে স্মিথ‏ ‎‡9 bn‏
400 0 ‎‡a Kenneth J Smith‏ ‎‡c researcher (ORCID 0000-0003-4408-7809)‏ ‎‡9 en‏
670 ‎‡a Author's A genome-wide gene-expression analysis and database in transgenic mice during development of amyloid or tau pathology‏
670 ‎‡a Author's A method to represent the spectrum of refractory periods of transmission of the constituent fibres of a nerve [proceedings]‏
670 ‎‡a Author's A multispectral microscope for in vivo oximetry of rat dorsal spinal cord vasculature‏
670 ‎‡a Author's A sensitive method for the detection and quantification of conduction deficits in nerve‏
670 ‎‡a Author's Axonal morphological changes following impulse activity in mouse peripheral nerve in vivo: the return pathway for sodium ions.‏
670 ‎‡a Author's Axonal protection achieved by blockade of sodium/calcium exchange in a new model of ischemia in vivo‏
670 ‎‡a Author's Axonal protection achieved in a model of multiple sclerosis using lamotrigine‏
670 ‎‡a Author's Axonal protection in experimental autoimmune neuritis by the sodium channel blocking agent flecainide.‏
670 ‎‡a Author's Axonal protection in multiple sclerosis--a particular need during remyelination?‏
670 ‎‡a Author's Axonal protection using flecainide in experimental autoimmune encephalomyelitis.‏
670 ‎‡a Author's Blood-Brain Barrier Function in Central Demyelinating Lesions Repaired by Schwann Cell Remyelination‏
670 ‎‡a Author's Cause and prevention of demyelination in a model multiple sclerosis lesion.‏
670 ‎‡a Author's Central remyelination restores secure conduction‏
670 ‎‡a Author's Clinical and imaging correlates of the multiple sclerosis impact scale in secondary progressive multiple sclerosis.‏
670 ‎‡a Author's Conduction properties of central nerve fibers remyelinated by Schwann cells‏
670 ‎‡a Author's Detection of cytochrome c oxidase activity and mitochondrial proteins in single cells‏
670 ‎‡a Author's Distribution of sodium channels in chronically demyelinated spinal cord axons: immuno-ultrastructural localization and electrophysiological observations‏
670 ‎‡a Author's Experimental autoimmune encephalomyelitis from a tissue energy perspective.‏
670 ‎‡a Author's Gallamine Triethiodide (Flaxedil): Tetraethylammonium- and Pancuronium-Like Effects in Myelinated Nerve Fibers‏
670 ‎‡a Author's Human immunoglobulin ameliorates rat experimental autoimmune neuritis‏
670 ‎‡a Author's Hyperspectral Imaging of the Hemodynamic and Metabolic States of the Exposed Cortex: Investigating a Commercial Snapshot Solution‏
670 ‎‡a Author's Hypothermia protects brain mitochondrial function from hypoxemia in a murine model of sepsis‏
670 ‎‡a Author's Immunohistochemical evidence of tissue hypoxia and astrogliosis in the rostral ventrolateral medulla of spontaneously hypertensive rats.‏
670 ‎‡a Author's Impulse conduction increases mitochondrial transport in adult mammalian peripheral nerves in vivo‏
670 ‎‡a Author's In Vivo Imaging of Flavoprotein Fluorescence During Hypoxia Reveals the Importance of Direct Arterial Oxygen Supply to Cerebral Cortex Tissue.‏
670 ‎‡a Author's Inflammation and primary demyelination induced by the intraspinal injection of lipopolysaccharide.‏
670 ‎‡a Author's Inflammation induced by innate immunity in the central nervous system leads to primary astrocyte dysfunction followed by demyelination.‏
670 ‎‡a Author's Lamotrigine for neuroprotection in secondary progressive multiple sclerosis: a randomised, double-blind, placebo-controlled, parallel-group trial.‏
670 ‎‡a Author's Lamotrigine monotherapy does not provide protection against the loss of optic nerve axons in a rat model of ocular hypertension.‏
670 ‎‡a Author's Lesion genesis in a subset of patients with multiple sclerosis: a role for innate immunity?‏
670 ‎‡a Author's Longitudinal changes in magnetisation transfer ratio in secondary progressive multiple sclerosis: data from a randomised placebo controlled trial of lamotrigine.‏
670 ‎‡a Author's Low concentrations of tetrodotoxin interact with tetrodotoxin-resistant voltage-gated sodium channels.‏
670 ‎‡a Author's Mitochondrial damage and "plugging" of transport selectively in myelinated, small-diameter axons are major early events in peripheral neuroinflammation‏
670 ‎‡a Author's Mitochondrial dysfunction is an important cause of neurological deficits in an inflammatory model of multiple sclerosis.‏
670 ‎‡a Author's Nerve conduction during peripheral demyelination and remyelination‏
670 ‎‡a Author's Neurological deficits caused by tissue hypoxia in neuroinflammatory disease‏
670 ‎‡a Author's Neuroprotection by safinamide in the 6-hydroxydopamine model of Parkinson's disease.‏
670 ‎‡a Author's Origins of gliogenic stem cell populations within adult skin and bone marrow.‏
670 ‎‡a Author's Oxidative tissue injury in multiple sclerosis is only partly reflected in experimental disease models.‏
670 ‎‡a Author's Perivascular spaces in the brain: anatomy, physiology and pathology‏
670 ‎‡a Author's Protection of cerebral microcirculation, mitochondrial function, and electrocortical activity by small-volume resuscitation with terlipressin in a rat model of haemorrhagic shock‏
670 ‎‡a Author's Remyelination in the spinal cord of the cat following intraspinal injections of lysolecithin‏
670 ‎‡a Author's Restoration of secure conduction by central demyelination‏
670 ‎‡a Author's Safinamide and flecainide protect axons and reduce microglial activation in models of multiple sclerosis.‏
670 ‎‡a Author's Sodium channels and multiple sclerosis: roles in symptom production, damage and therapy.‏
670 ‎‡a Author's Sodium-mediated axonal degeneration in inflammatory demyelinating disease.‏
670 ‎‡a Author's Spontaneous and evoked electrical discharges from a central demyelinating lesion‏
670 ‎‡a Author's The restoration of conduction by central remyelination‏
670 ‎‡a Author's The role of CD8(+) T cells in a model of multiple sclerosis induced with recombinant myelin oligodendrocyte glycoprotein.‏
670 ‎‡a Author's The translocator protein (TSPO) is prodromal to mitophagy loss in neurotoxicity‏
670 ‎‡a Author's Understanding a role for hypoxia in lesion formation and location in the deep and periventricular white matter in small vessel disease and multiple sclerosis.‏
670 ‎‡a Author's Vascular changes and demyelination induced by the intraneural injection of tumour necrosis factor‏
909 ‎‡a (orcid) 0000000344087809‏ ‎‡9 1‏
919 ‎‡a vascularchangesanddemyelinationinducedbytheintraneuralinjectionoftumournecrosisfactor‏ ‎‡A Vascular changes and demyelination induced by the intraneural injection of tumour necrosis factor‏ ‎‡9 1‏
919 ‎‡a causeandpreventionofdemyelinationinamodelmultiplesclerosislesion‏ ‎‡A Cause and prevention of demyelination in a model multiple sclerosis lesion.‏ ‎‡9 1‏
919 ‎‡a centralremyelinationrestoressecureconduction‏ ‎‡A Central remyelination restores secure conduction‏ ‎‡9 1‏
919 ‎‡a nerveconductionduringperipheraldemyelinationandremyelination‏ ‎‡A Nerve conduction during peripheral demyelination and remyelination‏ ‎‡9 1‏
919 ‎‡a mitochondrialdysfunctionisanimportantcauseofneurologicaldeficitsinaninflammatorymodelofmultiplesclerosis‏ ‎‡A Mitochondrial dysfunction is an important cause of neurological deficits in an inflammatory model of multiple sclerosis.‏ ‎‡9 1‏
919 ‎‡a clinicalandimagingcorrelatesofthemultiplesclerosisimpactscaleinsecondaryprogressivemultiplesclerosis‏ ‎‡A Clinical and imaging correlates of the multiple sclerosis impact scale in secondary progressive multiple sclerosis.‏ ‎‡9 1‏
919 ‎‡a mitochondrialdamageandpluggingoftransportselectivelyinmyelinatedsmalldiameteraxonsaremajorearlyeventsinperipheralneuroinflammation‏ ‎‡A Mitochondrial damage and "plugging" of transport selectively in myelinated, small-diameter axons are major early events in peripheral neuroinflammation‏ ‎‡9 1‏
919 ‎‡a originsofgliogenicstemcellpopulationswithinadultskinandbonemarrow‏ ‎‡A Origins of gliogenic stem cell populations within adult skin and bone marrow.‏ ‎‡9 1‏
919 ‎‡a safinamideandflecainideprotectaxonsandreducemicroglialactivationinmodelsofmultiplesclerosis‏ ‎‡A Safinamide and flecainide protect axons and reduce microglial activation in models of multiple sclerosis.‏ ‎‡9 1‏
919 ‎‡a oxidativetissueinjuryinmultiplesclerosisisonlypartlyreflectedinexperimentaldiseasemodels‏ ‎‡A Oxidative tissue injury in multiple sclerosis is only partly reflected in experimental disease models.‏ ‎‡9 1‏
919 ‎‡a sodiummediatedaxonaldegenerationininflammatorydemyelinatingdisease‏ ‎‡A Sodium-mediated axonal degeneration in inflammatory demyelinating disease.‏ ‎‡9 1‏
919 ‎‡a conductionpropertiesofcentralnervefibersremyelinatedbyschwanncells‏ ‎‡A Conduction properties of central nerve fibers remyelinated by Schwann cells‏ ‎‡9 1‏
919 ‎‡a detectionofcytochrome100oxidaseactivityandmitochondrialproteinsinsinglecells‏ ‎‡A Detection of cytochrome c oxidase activity and mitochondrial proteins in single cells‏ ‎‡9 1‏
919 ‎‡a distributionofsodiumchannelsinchronicallydemyelinatedspinalcordaxonsimmunoultrastructurallocalizationandelectrophysiologicalobservations‏ ‎‡A Distribution of sodium channels in chronically demyelinated spinal cord axons: immuno-ultrastructural localization and electrophysiological observations‏ ‎‡9 1‏
919 ‎‡a experimentalautoimmuneencephalomyelitisfromatissueenergyperspective‏ ‎‡A Experimental autoimmune encephalomyelitis from a tissue energy perspective.‏ ‎‡9 1‏
919 ‎‡a perivascularspacesinthebrainanatomyphysiologyandpathology‏ ‎‡A Perivascular spaces in the brain: anatomy, physiology and pathology‏ ‎‡9 1‏
919 ‎‡a axonalprotectioninmultiplesclerosisaparticularneedduringremyelination‏ ‎‡A Axonal protection in multiple sclerosis--a particular need during remyelination?‏ ‎‡9 1‏
919 ‎‡a gallaminetriethiodideflaxediltetraethylammoniumandpancuroniumlikeeffectsinmyelinatednervefibers‏ ‎‡A Gallamine Triethiodide (Flaxedil): Tetraethylammonium- and Pancuronium-Like Effects in Myelinated Nerve Fibers‏ ‎‡9 1‏
919 ‎‡a spontaneousandevokedelectricaldischargesfromacentraldemyelinatinglesion‏ ‎‡A Spontaneous and evoked electrical discharges from a central demyelinating lesion‏ ‎‡9 1‏
919 ‎‡a restorationofconductionbycentralremyelination‏ ‎‡A The restoration of conduction by central remyelination‏ ‎‡9 1‏
919 ‎‡a axonalprotectionachievedbyblockadeofsodiumcalciumexchangeinanewmodelofischemiainvivo‏ ‎‡A Axonal protection achieved by blockade of sodium/calcium exchange in a new model of ischemia in vivo‏ ‎‡9 1‏
919 ‎‡a roleofcd8+tcellsinamodelofmultiplesclerosisinducedwithrecombinantmyelinoligodendrocyteglycoprotein‏ ‎‡A The role of CD8(+) T cells in a model of multiple sclerosis induced with recombinant myelin oligodendrocyte glycoprotein.‏ ‎‡9 1‏
919 ‎‡a lamotrigineforneuroprotectioninsecondaryprogressivemultiplesclerosisarandomiseddoubleblindplacebocontrolledparallelgrouptrial‏ ‎‡A Lamotrigine for neuroprotection in secondary progressive multiple sclerosis: a randomised, double-blind, placebo-controlled, parallel-group trial.‏ ‎‡9 1‏
919 ‎‡a multispectralmicroscopeforinvivooximetryofratdorsalspinalcordvasculature‏ ‎‡A A multispectral microscope for in vivo oximetry of rat dorsal spinal cord vasculature‏ ‎‡9 1‏
919 ‎‡a genomewidegeneexpressionanalysisanddatabaseintransgenicmiceduringdevelopmentofamyloidortaupathology‏ ‎‡A A genome-wide gene-expression analysis and database in transgenic mice during development of amyloid or tau pathology‏ ‎‡9 1‏
919 ‎‡a humanimmunoglobulinamelioratesratexperimentalautoimmuneneuritis‏ ‎‡A Human immunoglobulin ameliorates rat experimental autoimmune neuritis‏ ‎‡9 1‏
919 ‎‡a methodtorepresentthespectrumofrefractoryperiodsoftransmissionoftheconstituentfibresofanerve‏ ‎‡A A method to represent the spectrum of refractory periods of transmission of the constituent fibres of a nerve [proceedings]‏ ‎‡9 1‏
919 ‎‡a hyperspectralimagingofthehemodynamicandmetabolicstatesoftheexposedcortexinvestigatingacommercialsnapshotsolution‏ ‎‡A Hyperspectral Imaging of the Hemodynamic and Metabolic States of the Exposed Cortex: Investigating a Commercial Snapshot Solution‏ ‎‡9 1‏
919 ‎‡a hypothermiaprotectsbrainmitochondrialfunctionfromhypoxemiainamurinemodelofsepsis‏ ‎‡A Hypothermia protects brain mitochondrial function from hypoxemia in a murine model of sepsis‏ ‎‡9 1‏
919 ‎‡a immunohistochemicalevidenceoftissuehypoxiaandastrogliosisintherostralventrolateralmedullaofspontaneouslyhypertensiverats‏ ‎‡A Immunohistochemical evidence of tissue hypoxia and astrogliosis in the rostral ventrolateral medulla of spontaneously hypertensive rats.‏ ‎‡9 1‏
919 ‎‡a lowconcentrationsoftetrodotoxininteractwithtetrodotoxinresistantvoltagegatedsodiumchannels‏ ‎‡A Low concentrations of tetrodotoxin interact with tetrodotoxin-resistant voltage-gated sodium channels.‏ ‎‡9 1‏
919 ‎‡a longitudinalchangesinmagnetisationtransferratioinsecondaryprogressivemultiplesclerosisdatafromarandomisedplacebocontrolledtrialoflamotrigine‏ ‎‡A Longitudinal changes in magnetisation transfer ratio in secondary progressive multiple sclerosis: data from a randomised placebo controlled trial of lamotrigine.‏ ‎‡9 1‏
919 ‎‡a impulseconductionincreasesmitochondrialtransportinadultmammalianperipheralnervesinvivo‏ ‎‡A Impulse conduction increases mitochondrial transport in adult mammalian peripheral nerves in vivo‏ ‎‡9 1‏
919 ‎‡a invivoimagingofflavoproteinfluorescenceduringhypoxiarevealstheimportanceofdirectarterialoxygensupplytocerebralcortextissue‏ ‎‡A In Vivo Imaging of Flavoprotein Fluorescence During Hypoxia Reveals the Importance of Direct Arterial Oxygen Supply to Cerebral Cortex Tissue.‏ ‎‡9 1‏
919 ‎‡a inflammationandprimarydemyelinationinducedbytheintraspinalinjectionoflipopolysaccharide‏ ‎‡A Inflammation and primary demyelination induced by the intraspinal injection of lipopolysaccharide.‏ ‎‡9 1‏
919 ‎‡a sodiumchannelsandmultiplesclerosisrolesinsymptomproductiondamageandtherapy‏ ‎‡A Sodium channels and multiple sclerosis: roles in symptom production, damage and therapy.‏ ‎‡9 1‏
919 ‎‡a inflammationinducedbyinnateimmunityinthecentralnervoussystemleadstoprimaryastrocytedysfunctionfollowedbydemyelination‏ ‎‡A Inflammation induced by innate immunity in the central nervous system leads to primary astrocyte dysfunction followed by demyelination.‏ ‎‡9 1‏
919 ‎‡a lamotriginemonotherapydoesnotprovideprotectionagainstthelossofopticnerveaxonsinaratmodelofocularhypertension‏ ‎‡A Lamotrigine monotherapy does not provide protection against the loss of optic nerve axons in a rat model of ocular hypertension.‏ ‎‡9 1‏
919 ‎‡a axonalprotectionusingflecainideinexperimentalautoimmuneencephalomyelitis‏ ‎‡A Axonal protection using flecainide in experimental autoimmune encephalomyelitis.‏ ‎‡9 1‏
919 ‎‡a remyelinationinthespinalcordofthecatfollowingintraspinalinjectionsoflysolecithin‏ ‎‡A Remyelination in the spinal cord of the cat following intraspinal injections of lysolecithin‏ ‎‡9 1‏
919 ‎‡a bloodbrainbarrierfunctionincentraldemyelinatinglesionsrepairedbyschwanncellremyelination‏ ‎‡A Blood-Brain Barrier Function in Central Demyelinating Lesions Repaired by Schwann Cell Remyelination‏ ‎‡9 1‏
919 ‎‡a restorationofsecureconductionbycentraldemyelination‏ ‎‡A Restoration of secure conduction by central demyelination‏ ‎‡9 1‏
919 ‎‡a translocatorproteintspoisprodromaltomitophagylossinneurotoxicity‏ ‎‡A The translocator protein (TSPO) is prodromal to mitophagy loss in neurotoxicity‏ ‎‡9 1‏
919 ‎‡a protectionofcerebralmicrocirculationmitochondrialfunctionandelectrocorticalactivitybysmallvolumeresuscitationwithterlipressininaratmodelofhaemorrhagicshock‏ ‎‡A Protection of cerebral microcirculation, mitochondrial function, and electrocortical activity by small-volume resuscitation with terlipressin in a rat model of haemorrhagic shock‏ ‎‡9 1‏
919 ‎‡a lesiongenesisinasubsetofpatientswithmultiplesclerosisaroleforinnateimmunity‏ ‎‡A Lesion genesis in a subset of patients with multiple sclerosis: a role for innate immunity?‏ ‎‡9 1‏
919 ‎‡a axonalprotectioninexperimentalautoimmuneneuritisbythesodiumchannelblockingagentflecainide‏ ‎‡A Axonal protection in experimental autoimmune neuritis by the sodium channel blocking agent flecainide.‏ ‎‡9 1‏
919 ‎‡a axonalprotectionachievedinamodelofmultiplesclerosisusinglamotrigine‏ ‎‡A Axonal protection achieved in a model of multiple sclerosis using lamotrigine‏ ‎‡9 1‏
919 ‎‡a neurologicaldeficitscausedbytissuehypoxiainneuroinflammatorydisease‏ ‎‡A Neurological deficits caused by tissue hypoxia in neuroinflammatory disease‏ ‎‡9 1‏
919 ‎‡a axonalmorphologicalchangesfollowingimpulseactivityinmouseperipheralnerveinvivothereturnpathwayforsodiumions‏ ‎‡A Axonal morphological changes following impulse activity in mouse peripheral nerve in vivo: the return pathway for sodium ions.‏ ‎‡9 1‏
919 ‎‡a neuroprotectionbysafinamideinthe6hydroxydopaminemodelofparkinsonsdisease‏ ‎‡A Neuroprotection by safinamide in the 6-hydroxydopamine model of Parkinson's disease.‏ ‎‡9 1‏
919 ‎‡a sensitivemethodforthedetectionandquantificationofconductiondeficitsinnerve‏ ‎‡A A sensitive method for the detection and quantification of conduction deficits in nerve‏ ‎‡9 1‏
919 ‎‡a understandingaroleforhypoxiainlesionformationandlocationinthedeepandperiventricularwhitematterinsmallvesseldiseaseandmultiplesclerosis‏ ‎‡A Understanding a role for hypoxia in lesion formation and location in the deep and periventricular white matter in small vessel disease and multiple sclerosis.‏ ‎‡9 1‏
996 ‎‡2 LC|n 93045168‏
996 ‎‡2 CAOONL|ncf10730539‏
996 ‎‡2 ISNI|000000003722819X‏
996 ‎‡2 J9U|987007383042305171‏
996 ‎‡2 NTA|068613733‏
996 ‎‡2 ISNI|0000000033427765‏
996 ‎‡2 NKC|jcu2013767141‏
996 ‎‡2 BNF|16672515‏
996 ‎‡2 NII|DA02368745‏
996 ‎‡2 LC|nb2013019294‏
996 ‎‡2 ISNI|0000000026660198‏
996 ‎‡2 ISNI|0000000114585298‏
996 ‎‡2 SUDOC|187198721‏
996 ‎‡2 SUDOC|240876881‏
996 ‎‡2 W2Z|1615360582159‏
996 ‎‡2 NTA|317850342‏
996 ‎‡2 LC|no2017116026‏
996 ‎‡2 NUKAT|n 2018040078‏
996 ‎‡2 LC|n 87129157‏
996 ‎‡2 DNB|134845315‏
996 ‎‡2 LC|nb2016003838‏
996 ‎‡2 SUDOC|164716718‏
996 ‎‡2 LC|n 87154340‏
996 ‎‡2 LC|n 92006675‏
996 ‎‡2 LC|n 90669180‏
996 ‎‡2 DNB|1053164912‏
996 ‎‡2 ISNI|0000000499837619‏
996 ‎‡2 ISNI|000000041018427X‏
996 ‎‡2 NTA|271268891‏
996 ‎‡2 ISNI|0000000369518476‏
996 ‎‡2 ISNI|0000000040389760‏
996 ‎‡2 LC|n 90624951‏
996 ‎‡2 ISNI|0000000029357477‏
996 ‎‡2 LC|n 84133007‏
996 ‎‡2 LC|n 95000557‏
996 ‎‡2 NII|DA0284970X‏
996 ‎‡2 CAOONL|ncf10993566‏
996 ‎‡2 LC|n 2021000827‏
996 ‎‡2 LC|n 84120882‏
996 ‎‡2 LC|n 84003121‏
996 ‎‡2 ISNI|0000000110770445‏
996 ‎‡2 NTA|070160961‏
996 ‎‡2 ISNI|0000000383293306‏
996 ‎‡2 RERO|A003839563‏
996 ‎‡2 LC|no2022090268‏
996 ‎‡2 ISNI|0000000022879432‏
996 ‎‡2 NTA|068180756‏
996 ‎‡2 ISNI|0000000379434647‏
996 ‎‡2 ISNI|0000000387932830‏
996 ‎‡2 NLA|000035507036‏
996 ‎‡2 ISNI|0000000049340269‏
996 ‎‡2 NLA|000035507039‏
996 ‎‡2 LC|n 85335654‏
996 ‎‡2 LC|no2014026403‏
996 ‎‡2 J9U|987007280443905171‏
996 ‎‡2 JPG|500036502‏
996 ‎‡2 BNF|15981192‏
996 ‎‡2 ISNI|0000000039709675‏
996 ‎‡2 NUKAT|n 95005655‏
996 ‎‡2 ISNI|000000003235201X‏
996 ‎‡2 NUKAT|n 2009133369‏
996 ‎‡2 NII|DA17665777‏
996 ‎‡2 LC|no2004097816‏
996 ‎‡2 ISNI|0000000063386124‏
996 ‎‡2 CAOONL|ncf11029819‏
996 ‎‡2 LC|n 2003073710‏
996 ‎‡2 DNB|1061473538‏
996 ‎‡2 LC|n 2018018889‏
996 ‎‡2 ISNI|0000000076697087‏
996 ‎‡2 LC|n 87937280‏
996 ‎‡2 LC|n 87937281‏
996 ‎‡2 ISNI|0000000115595041‏
996 ‎‡2 ISNI|0000000076102653‏
996 ‎‡2 ISNI|0000000031144032‏
996 ‎‡2 SUDOC|17876843X‏
996 ‎‡2 LC|n 88275033‏
996 ‎‡2 LC|n 92059593‏
996 ‎‡2 LC|n 81105745‏
996 ‎‡2 BIBSYS|90261466‏
996 ‎‡2 BNF|16993322‏
996 ‎‡2 LC|n 86868492‏
996 ‎‡2 ISNI|0000000082197150‏
996 ‎‡2 LC|n 85139803‏
996 ‎‡2 LIH|LNB:C_k__s_5;=B2‏
996 ‎‡2 J9U|987007331029805171‏
996 ‎‡2 LC|n 85022743‏
996 ‎‡2 NUKAT|n 2017175978‏
996 ‎‡2 J9U|987007597711805171‏
996 ‎‡2 ISNI|0000000033161522‏
996 ‎‡2 ISNI|0000000066594551‏
996 ‎‡2 BIBSYS|90803156‏
996 ‎‡2 NSK|000064856‏
996 ‎‡2 LC|n 82029528‏
996 ‎‡2 JPG|500227329‏
996 ‎‡2 NKC|skuk0002112‏
996 ‎‡2 CAOONL|ncf10991518‏
996 ‎‡2 DNB|1141921421‏
996 ‎‡2 J9U|987007429727405171‏
996 ‎‡2 SIMACOB|135397987‏
996 ‎‡2 CAOONL|ncf11286470‏
996 ‎‡2 CAOONL|ncf10336504‏
996 ‎‡2 BIBSYS|9066568‏
996 ‎‡2 BIBSYS|5061374‏
996 ‎‡2 ISNI|0000000063027463‏
996 ‎‡2 LC|n 87822981‏
996 ‎‡2 RERO|A027043255‏
996 ‎‡2 CAOONL|ncf10933935‏
996 ‎‡2 ISNI|0000000107315900‏
996 ‎‡2 LC|n 83013140‏
996 ‎‡2 JPG|500109768‏
996 ‎‡2 ISNI|0000000107174319‏
996 ‎‡2 LC|n 2013036471‏
996 ‎‡2 CAOONL|ncf10117911‏
996 ‎‡2 DBC|87097992174654‏
996 ‎‡2 ISNI|0000000081405253‏
996 ‎‡2 BIBSYS|13041812‏
996 ‎‡2 DNB|1089153139‏
996 ‎‡2 LC|nb2004304426‏
996 ‎‡2 NTA|102592004‏
996 ‎‡2 ISNI|0000000043414925‏
996 ‎‡2 LC|n 2011047865‏
996 ‎‡2 JPG|500096477‏
996 ‎‡2 J9U|987007375816805171‏
996 ‎‡2 CAOONL|ncf10539390‏
996 ‎‡2 LC|no2018155967‏
996 ‎‡2 NUKAT|n 2005112602‏
996 ‎‡2 ISNI|0000000038441355‏
996 ‎‡2 ISNI|0000000028520252‏
996 ‎‡2 DNB|170612767‏
996 ‎‡2 DBC|87097992174727‏
996 ‎‡2 BIBSYS|90157611‏
996 ‎‡2 RERO|A011158733‏
996 ‎‡2 SUDOC|235028347‏
996 ‎‡2 SUDOC|030461200‏
996 ‎‡2 LC|n 86807279‏
996 ‎‡2 BNF|15500086‏
996 ‎‡2 NTA|157169707‏
996 ‎‡2 ISNI|0000000000879511‏
996 ‎‡2 BLBNB|000357481‏
996 ‎‡2 LC|no2003093406‏
996 ‎‡2 CAOONL|ncf10120079‏
996 ‎‡2 BNF|16248405‏
996 ‎‡2 NII|DA01738328‏
996 ‎‡2 DNB|1089777493‏
996 ‎‡2 ISNI|0000000083316940‏
996 ‎‡2 DNB|170666352‏
996 ‎‡2 LC|nb2006006700‏
996 ‎‡2 ISNI|0000000082347462‏
996 ‎‡2 LC|n 91098182‏
996 ‎‡2 CAOONL|ncf10358043‏
996 ‎‡2 ISNI|0000000498512927‏
996 ‎‡2 CAOONL|ncf10193211‏
996 ‎‡2 SUDOC|279958595‏
996 ‎‡2 BIBSYS|90004946‏
996 ‎‡2 ISNI|0000000021598436‏
996 ‎‡2 SUDOC|074611658‏
996 ‎‡2 ISNI|0000000123277086‏
996 ‎‡2 SUDOC|251547019‏
996 ‎‡2 LC|no2006079439‏
996 ‎‡2 LC|n 89652656‏
996 ‎‡2 PTBNP|576924‏
996 ‎‡2 RERO|A026883097‏
996 ‎‡2 BNF|17079528‏
996 ‎‡2 LC|no2007120005‏
996 ‎‡2 NUKAT|n 99043852‏
996 ‎‡2 LC|n 50025224‏
996 ‎‡2 LC|n 50025225‏
996 ‎‡2 ISNI|0000000496292203‏
996 ‎‡2 SUDOC|093633610‏
996 ‎‡2 ISNI|0000000067126258‏
996 ‎‡2 ISNI|0000000032086188‏
996 ‎‡2 LC|nb2013002799‏
996 ‎‡2 ISNI|0000000115120767‏
996 ‎‡2 BIBSYS|90103068‏
996 ‎‡2 DNB|1078986258‏
996 ‎‡2 ISNI|0000000025202523‏
996 ‎‡2 JPG|500191360‏
996 ‎‡2 LC|n 80019107‏
996 ‎‡2 NDL|001093839‏
996 ‎‡2 NTA|401466019‏
996 ‎‡2 LC|nb2013014670‏
996 ‎‡2 DNB|102207380X‏
996 ‎‡2 NTA|19421012X‏
996 ‎‡2 BNF|17124130‏
996 ‎‡2 ISNI|0000000110726196‏
996 ‎‡2 NSK|000196000‏
996 ‎‡2 LC|n 78096478‏
996 ‎‡2 ISNI|0000000108447964‏
996 ‎‡2 ISNI|0000000046287722‏
996 ‎‡2 NTA|074718665‏
996 ‎‡2 LC|n 80002506‏
996 ‎‡2 NKC|ctu2018983334‏
996 ‎‡2 LC|n 00122222‏
996 ‎‡2 ISNI|0000000026897750‏
996 ‎‡2 ISNI|0000000067529153‏
996 ‎‡2 LC|nb2012012142‏
996 ‎‡2 LC|n 95095217‏
996 ‎‡2 NYNYRILM|65728‏
996 ‎‡2 NTA|068429878‏
996 ‎‡2 LC|n 88670732‏
996 ‎‡2 BIBSYS|9066459‏
996 ‎‡2 LC|n 85801524‏
996 ‎‡2 SUDOC|185164684‏
996 ‎‡2 CAOONL|ncf10017020‏
996 ‎‡2 ISNI|0000000110815818‏
996 ‎‡2 LC|n 79109413‏
996 ‎‡2 SUDOC|113420080‏
996 ‎‡2 J9U|987012722491905171‏
996 ‎‡2 LC|n 2010050256‏
996 ‎‡2 BNF|12278902‏
996 ‎‡2 NTA|074305042‏
996 ‎‡2 SUDOC|031606695‏
996 ‎‡2 BLBNB|000985589‏
996 ‎‡2 J9U|987007461319605171‏
996 ‎‡2 LC|n 96034700‏
996 ‎‡2 BIBSYS|90346689‏
996 ‎‡2 NUKAT|n 2005038459‏
996 ‎‡2 BNC|981058616449006706‏
996 ‎‡2 NII|DA03167250‏
996 ‎‡2 J9U|987012502679205171‏
996 ‎‡2 DNB|1177173921‏
996 ‎‡2 BNF|14490400‏
996 ‎‡2 SUDOC|085836907‏
996 ‎‡2 RERO|A003839579‏
996 ‎‡2 NKC|jn20001227097‏
996 ‎‡2 BNF|16915828‏
996 ‎‡2 NKC|jx20041102005‏
996 ‎‡2 ISNI|0000000472406894‏
996 ‎‡2 LC|n 87872169‏
996 ‎‡2 LC|n 2005080835‏
996 ‎‡2 ISNI|0000000500337516‏
996 ‎‡2 ISNI|000000043030892X‏
996 ‎‡2 NLA|000035507043‏
996 ‎‡2 NLA|000035507048‏
996 ‎‡2 ISNI|0000000459751220‏
996 ‎‡2 SELIBR|381933‏
996 ‎‡2 ISNI|0000000076443220‏
996 ‎‡2 ISNI|0000000027743745‏
996 ‎‡2 CAOONL|ncf10139663‏
996 ‎‡2 NLA|000035260002‏
996 ‎‡2 PLWABN|9811739335805606‏
996 ‎‡2 ISNI|0000000084426412‏
996 ‎‡2 NTA|067893929‏
996 ‎‡2 ISNI|0000000035164145‏
996 ‎‡2 LC|no2022088283‏
996 ‎‡2 ISNI|0000000031062643‏
996 ‎‡2 CAOONL|ncf12027590‏
996 ‎‡2 DNB|174075456‏
996 ‎‡2 LC|n 96052772‏
996 ‎‡2 ISNI|0000000393337544‏
997 ‎‡a 0 0 lived 0 0‏ ‎‡9 1‏