VIAF

Virtual International Authority File

Search

Leader 00000nz a2200037n 45 0
001 WKP|Q79665386 (VIAF cluster) (Authority/Source Record)
003 WKP
005 20241120235936.0
008 241120nneanz||abbn n and d
035 ‎‡a (WKP)Q79665386‏
024 ‎‡a 0000-0003-4767-7564‏ ‎‡2 orcid‏
024 ‎‡a 8527655300‏ ‎‡2 scopus‏
035 ‎‡a (OCoLC)Q79665386‏
100 0 ‎‡a Soon-Tae Lee‏ ‎‡c researcher‏ ‎‡9 en‏
400 0 ‎‡a Soon-Tae Lee‏ ‎‡c wetenschapper‏ ‎‡9 nl‏
670 ‎‡a Author's A cell-free extract from human adipose stem cells protects mice against epilepsy‏
670 ‎‡a Author's A novel indicator, the "Jinx sign," is associated with an altered frontal-basal ganglionic connection‏
670 ‎‡a Author's Abnormal activation of motor cortical network during phasic REM sleep in idiopathic REM sleep behavior disorder‏
670 ‎‡a Author's Acquired encephalopathy associated with carnitine deficiency after cefditoren pivoxil administration‏
670 ‎‡a Author's Acute Symptomatic Basilar Artery Stenosis: MR Imaging Predictors of Early Neurologic Deterioration and Long-term Outcomes‏
670 ‎‡a Author's Altered behavior and neural activity in conspecific cagemates co-housed with mouse models of brain disorders‏
670 ‎‡a Author's Altered expression of miR-202 in cerebellum of multiple-system atrophy‏
670 ‎‡a Author's Altered Expression of the Long Noncoding RNA NEAT1 in Huntington's Disease.‏
670 ‎‡a Author's Altered Functional Connectivity in Idiopathic Rapid Eye Movement Sleep Behavior Disorder: A Resting-State EEG Study‏
670 ‎‡a Author's Altered long noncoding RNA profile after intracerebral hemorrhage‏
670 ‎‡a Author's Altered microRNA regulation in Huntington's disease models‏
670 ‎‡a Author's Altered Network Characteristics of Spike-Wave Discharges in Juvenile Myoclonic Epilepsy.‏
670 ‎‡a Author's Altered resting-state thalamo-occipital functional connectivity is associated with cognition in isolated rapid eye movement sleep behavior disorder‏
670 ‎‡a Author's An illustrative case of mixed pesticide poisoning with remarkable improvement: a case report‏
670 ‎‡a Author's Anti-inflammatory mechanism of intravascular neural stem cell transplantation in haemorrhagic stroke‏
670 ‎‡a Author's Anti-LGI1 encephalitis is associated with unique HLA subtypes.‏
670 ‎‡a Author's Anti-LGI1 Limbic Encephalitis Presented with Atypical Manifestations‏
670 ‎‡a Author's Anti-N-methyl-d-aspartate receptor encephalitis in Korea: clinical features, treatment, and outcome‏
670 ‎‡a Author's Antiepileptic Drug Selection According to Seizure Type in Adult Patients with Epilepsy‏
670 ‎‡a Author's Association of blood pressure variability with orthostatic intolerance symptoms.‏
670 ‎‡a Author's Association of Bone Mineral Density With the Risk of Intracranial Aneurysm‏
670 ‎‡a Author's Association of Cardiac Hemodynamic Factors With Severity of White Matter Hyperintensities in Chronic Valvular Heart Disease‏
670 ‎‡a Author's Atherosclerosis-Related Circulating MicroRNAs as a Predictor of Stroke Recurrence‏
670 ‎‡a Author's Atorvastatin attenuates mitochondrial toxin-induced striatal degeneration, with decreasing iNOS/c-Jun levels and activating ERK/Akt pathways‏
670 ‎‡a Author's Augmentation of nitrite therapy in cerebral ischemia by NMDA receptor inhibition‏
670 ‎‡a Author's Autophagy is involved in the ischemic preconditioning‏
670 ‎‡a Author's Blockade of AT1 receptor reduces apoptosis, inflammation, and oxidative stress in normotensive rats with intracerebral hemorrhage‏
670 ‎‡a Author's Bortezomib treatment for severe refractory anti-NMDA receptor encephalitis.‏
670 ‎‡a Author's Brain response characteristics associated with subclavian steal phenomenon.‏
670 ‎‡a Author's Brainstem encephalitis caused by Coxiella burnetii‏
670 ‎‡a Author's Bright light exposure before bedtime impairs response inhibition the following morning: a non-randomized crossover study.‏
670 ‎‡a Author's c-Cbl regulates αPix-mediated cell migration and invasion.‏
670 ‎‡a Author's Ca<sub>V</sub> α2δ Autoimmune Encephalitis: A Novel Antibody and its Characteristics‏
670 ‎‡a Author's Campylobacter fetus meningitis confirmed by a 16S rRNA gene analysis using the MinION nanopore sequencer, South Korea, 2016.‏
670 ‎‡a Author's Capability of arterial spin labeling MR imaging in localizing seizure focus in clinical seizure activity‏
670 ‎‡a Author's Cardiac sympathetic dysfunction in anti-NMDA receptor encephalitis‏
670 ‎‡a Author's Case of Rickettsia typhi-induced Brain Abscess Mimicking Brain Tumor.‏
670 ‎‡a Author's Celecoxib induces functional recovery after intracerebral hemorrhage with reduction of brain edema and perihematomal cell death‏
670 ‎‡a Author's Cell proliferation and synaptogenesis in the cerebellum after focal cerebral ischemia.‏
670 ‎‡a Author's Central nervous system complications after liver transplantation.‏
670 ‎‡a Author's Central Nervous System Infection Associated with Orientia tsutsugamushi in South Korea.‏
670 ‎‡a Author's Cerebral autoinflammatory disease treated with anakinra.‏
670 ‎‡a Author's Change of Patient Selection Strategy and Improved Surgical Outcome in MRI-negative Neocortical Epilepsy‏
670 ‎‡a Author's Characteristics of Epilepsy Patients who Committed Violent Crimes: Report from the National Forensic Hospital‏
670 ‎‡a Author's Cholinergic anti-inflammatory pathway in intracerebral hemorrhage‏
670 ‎‡a Author's Circulating CD62E+ microparticles and cardiovascular outcomes‏
670 ‎‡a Author's Circulating endothelial microparticles as a marker of cerebrovascular disease.‏
670 ‎‡a Author's Circulating endothelial progenitor cells as a new marker of endothelial dysfunction or repair in acute stroke‏
670 ‎‡a Author's Circulating endothelial progenitor cells as a pathogenetic marker of moyamoya disease‏
670 ‎‡a Author's Clinical and angiographic factors related to the prognosis of cavernous sinus dural arteriovenous fistula‏
670 ‎‡a Author's Clinical Applications of Simultaneous PET/MR Imaging Using (R)-[11C]-Verapamil with Cyclosporin A: Preliminary Results on a Surrogate Marker of Drug-Resistant Epilepsy.‏
670 ‎‡a Author's Clinical Approach to Autoimmune Epilepsy‏
670 ‎‡a Author's Clinical Characteristics of Severe Japanese Encephalitis: A Case Series from South Korea.‏
670 ‎‡a Author's Clinical characterization of unknown/cryptogenic status epilepticus suspected as encephalitis: A multicenter cohort study.‏
670 ‎‡a Author's Clinical manifestation of cancer related stroke: retrospective case-control study‏
670 ‎‡a Author's Clinical manifestations and outcomes of the treatment of patients with GABAB encephalitis‏
670 ‎‡a Author's Clinical manifestations and treatment outcomes of parvovirus B19 encephalitis in immunocompetent adults.‏
670 ‎‡a Author's Clinical manifestations of patients with CASPR2 antibodies.‏
670 ‎‡a Author's Clinical observation of lymphopenia in patients with newly diagnosed glioblastoma‏
670 ‎‡a Author's Clustering of spontaneous recurrent seizures separated by long seizure-free periods: An extended video-EEG monitoring study of a pilocarpine mouse model.‏
670 ‎‡a Author's Combined neuroprotective effects of celecoxib and memantine in experimental intracerebral hemorrhage‏
670 ‎‡a Author's Combined treatment of vascular endothelial growth factor and human neural stem cells in experimental focal cerebral ischemia‏
670 ‎‡a Author's Comorbid Depression Is Associated with a Negative Treatment Response in Idiopathic REM Sleep Behavior Disorder‏
670 ‎‡a Author's Comparison of Genetic Profiles and Prognosis of High-Grade Gliomas Using Quantitative and Qualitative MRI Features: A Focus on G3 Gliomas‏
670 ‎‡a Author's Continuous cytosine-b-D-arabinofuranoside infusion reduces ectopic granule cells in adult rat hippocampus with attenuation of spontaneous recurrent seizures following pilocarpine-induced status epilepticus‏
670 ‎‡a Author's Correction: Clustering of spontaneous recurrent seizures separated by long seizure-free periods: An extended video-EEG monitoring study of a pilocarpine mouse model‏
670 ‎‡a Author's Correction: Direct Generation of Neurosphere-Like Cells from Human Dermal Fibroblasts‏
670 ‎‡a Author's Corrigendum to "Altered resting-state thalamo-occipital functional connectivity is associated with cognition in isolated rapid eye movement sleep behavior disorder" [Sleep Med 69 (2020) 198-203]‏
670 ‎‡a Author's Criminal manifestations of dementia patients: report from the national forensic hospital‏
670 ‎‡a Author's Cyclooxygenase-2 inhibitor, celecoxib, inhibits the altered hippocampal neurogenesis with attenuation of spontaneous recurrent seizures following pilocarpine-induced status epilepticus‏
670 ‎‡a Author's Cystatin C, a potential marker for cerebral microvascular compliance, is associated with white-matter hyperintensities progression.‏
670 ‎‡a Author's Delayed orthostatic hypotension: Severity of clinical symptoms and response to medical treatment‏
670 ‎‡a Author's Deleterious c-Cbl Exon Skipping Contributes to Human Glioma.‏
670 ‎‡a Author's Depletion of nerve growth factor in chemotherapy-induced peripheral neuropathy associated with hematologic malignancies‏
670 ‎‡a Author's Development of LGI1 antibody encephalitis after treatment of lung cancer‏
670 ‎‡a Author's Development of the clinical assessment scale in autoimmune encephalitis‏
670 ‎‡a Author's Diagnosis of Haemophilus influenzae Pneumonia by Nanopore 16S Amplicon Sequencing of Sputum‏
670 ‎‡a Author's Differentiation of High-Grade from Low-Grade Astrocytoma: Improvement in Diagnostic Accuracy and Reliability of Pharmacokinetic Parameters from DCE MR Imaging by Using Arterial Input Functions Obtained from DSC MR Imaging.‏
670 ‎‡a Author's Direct generation of neurosphere-like cells from human dermal fibroblasts‏
670 ‎‡a Author's Distinct Expression of Long Non-Coding RNAs in an Alzheimer's Disease Model.‏
670 ‎‡a Author's Distinct intrathecal interleukin-17/interleukin-6 activation in anti-N-methyl-d-aspartate receptor encephalitis.‏
670 ‎‡a Author's Dynamic contrast-enhanced MR imaging in predicting progression of enhancing lesions persisting after standard treatment in glioblastoma patients: a prospective study.‏
670 ‎‡a Author's Dynamic Contrast-Enhanced MR Imaging of Nonenhancing T2 High-Signal-Intensity Lesions in Baseline and Posttreatment Glioblastoma: Temporal Change and Prognostic Value‏
670 ‎‡a Author's Dysfunctional characteristics of circulating angiogenic cells in Alzheimer's disease.‏
670 ‎‡a Author's Dysregulated long non-coding RNAs in the temporal lobe epilepsy mouse model.‏
670 ‎‡a Author's Dysregulation of long non-coding RNAs in mouse models of localization-related epilepsy.‏
670 ‎‡a Author's Early diagnosis of Alzheimer's disease from elevated olfactory mucosal miR-206 level.‏
670 ‎‡a Author's Early intravenous infusion of sodium nitrite protects brain against in vivo ischemia-reperfusion injury‏
670 ‎‡a Author's Echocardiographic evidence of innate aortopathy in the human intracranial aneurysm‏
670 ‎‡a Author's Echocardiographic index E/e' in association with cerebral white matter hyperintensity progression‏
670 ‎‡a Author's Effect of Immunotherapy on Seizure Outcome in Patients with Autoimmune Encephalitis: A Prospective Observational Registry Study‏
670 ‎‡a Author's Effects of long term nitrite therapy on functional recovery in experimental ischemia model.‏
670 ‎‡a Author's Efficacy of atomoxetine versus midodrine for neurogenic orthostatic hypotension‏
670 ‎‡a Author's Efficacy of Propranolol, Bisoprolol, and Pyridostigmine for Postural Tachycardia Syndrome: a Randomized Clinical Trial.‏
670 ‎‡a Author's Efficacy of single or combined midodrine and pyridostigmine in orthostatic hypotension‏
670 ‎‡a Author's Erratum to: Loss of Pericytes in Radiation Necrosis after Glioblastoma Treatments.‏
670 ‎‡a Author's Erythropoietin improves memory function with reducing endothelial dysfunction and amyloid-beta burden in Alzheimer's disease models‏
670 ‎‡a Author's Erythropoietin reduces epileptogenic processes following status epilepticus‏
670 ‎‡a Author's Erythropoietin reduces perihematomal inflammation and cell death with eNOS and STAT3 activations in experimental intracerebral hemorrhage‏
670 ‎‡a Author's Etiology and prognosis of non-convulsive status epilepticus‏
670 ‎‡a Author's Exosome-Based Delivery of miR-124 in a Huntington's Disease Model‏
670 ‎‡a Author's Experimental Induction of Cerebral Aneurysms by Developmental Low Copper Diet‏
670 ‎‡a Author's Extracts of adipose derived stem cells slows progression in the R6/2 model of Huntington's disease‏
670 ‎‡a Author's Fatal familial insomnia presenting with agrypnia excitata and very low atonia index level: A case report and literature review‏
670 ‎‡a Author's Feasibility and Safety of Intra-arterial Pericyte Progenitor Cell Delivery Following Mannitol-Induced Transient Blood-Brain Barrier Opening in a Canine Model‏
670 ‎‡a Author's Frequency of and risk factors for oxcarbazepine-induced severe and symptomatic hyponatremia‏
670 ‎‡a Author's Frequent rhabdomyolysis in anti-NMDA receptor encephalitis‏
670 ‎‡a Author's G-CSF protects human cerebral hybrid neurons against in vitro ischemia‏
670 ‎‡a Author's Galantamine reduces striatal degeneration in 3-nitropropionic acid model of Huntington's disease.‏
670 ‎‡a Author's Gamma oscillation in functional brain networks is involved in the spontaneous remission of depressive behavior induced by chronic restraint stress in mice‏
670 ‎‡a Author's Granulocyte-colony stimulating factor attenuates striatal degeneration with activating survival pathways in 3-nitropropionic acid model of Huntington's disease‏
670 ‎‡a Author's Granulocyte colony-stimulating factor enhances angiogenesis after focal cerebral ischemia‏
670 ‎‡a Author's Granulocyte colony-stimulating factor induces sensorimotor recovery in intracerebral hemorrhage‏
670 ‎‡a Author's Granulocyte colony-stimulating factor stimulates neurogenesis via vascular endothelial growth factor with STAT activation‏
670 ‎‡a Author's Heat-processed ginseng enhances the cognitive function in patients with moderately severe Alzheimer's disease.‏
670 ‎‡a Author's High albumin level is a predictor of favorable response to immunotherapy in autoimmune encephalitis‏
670 ‎‡a Author's High Cell-Free DNA Levels in Cerebrospinal Fluid Predict Leptomeningeal Seeding of Hematologic Malignancy‏
670 ‎‡a Author's High-Fat Diet and Voluntary Chronic Aerobic Exercise Recover Altered Levels of Aging-Related Tryptophan Metabolites along the Kynurenine Pathway‏
670 ‎‡a Author's HLA-A*11:01 is associated with levetiracetam-induced psychiatric adverse events‏
670 ‎‡a Author's HLA-A*31:01 and lamotrigine-induced severe cutaneous adverse drug reactions in a Korean population‏
670 ‎‡a Author's HLA-B*40:02 and DRB1*04:03 are risk factors for oxcarbazepine-induced maculopapular eruption‏
670 ‎‡a Author's HLA-B27 association of autoimmune encephalitis induced by PD-L1 inhibitor‏
670 ‎‡a Author's HLAs associated with perampanel-induced psychiatric adverse effects in a Korean population‏
670 ‎‡a Author's HMG-CoA reductase inhibitor, atorvastatin, promotes sensorimotor recovery, suppressing acute inflammatory reaction after experimental intracerebral hemorrhage‏
670 ‎‡a Author's Human embryonic stem cell-derived neural precursor transplants attenuate apomorphine-induced rotational behavior in rats with unilateral quinolinic acid lesions‏
670 ‎‡a Author's Human leukocyte antigen associations in postural tachycardia syndrome‏
670 ‎‡a Author's Human neural stem cell transplantation reduces spontaneous recurrent seizures following pilocarpine-induced status epilepticus in adult rats‏
670 ‎‡a Author's Human neural stem cells improve sensorimotor deficits in the adult rat brain with experimental focal ischemia‏
670 ‎‡a Author's Ictal asystole and eating reflex seizures with temporal lobe epilepsy.‏
670 ‎‡a Author's Identification of cerebral perfusion using arterial spin labeling in patients with seizures in acute settings‏
670 ‎‡a Author's Identification of neuronal outgrowth cells from peripheral blood of stroke patients.‏
670 ‎‡a Author's Impact of a selective cyclooxygenase-2 inhibitor, celecoxib, on cortical excitability and electrophysiological properties of the brain in healthy volunteers: A randomized, double-blind, placebo-controlled study‏
670 ‎‡a Author's Impact of interim progression during the surgery-to-radiotherapy interval and its predictors in glioblastoma treated with temozolomide-based radiochemotherapy.‏
670 ‎‡a Author's Impact of stroke mechanism in acute basilar occlusion with reperfusion therapy.‏
670 ‎‡a Author's Improvement of cognitive deficit in Alzheimer's disease patients by long term treatment with korean red ginseng‏
670 ‎‡a Author's Increased adverse events associated with antiepileptic drugs in anti-leucine-rich glioma-inactivated protein 1 encephalitis‏
670 ‎‡a Author's Increased arterial pulsatility and progression of single subcortical infarction.‏
670 ‎‡a Author's Increased circulating endothelial microparticles and carotid atherosclerosis in obstructive sleep apnea.‏
670 ‎‡a Author's Increasing prevalence of antimicrobial resistance in urinary tract infections of neurological patients, Seoul, South Korea, 2007-2016‏
670 ‎‡a Author's Induction of burst suppression or coma using intravenous anesthetics in refractory status epilepticus‏
670 ‎‡a Author's Inhibition of Let7c microRNA is neuroprotective in a rat intracerebral hemorrhage model‏
670 ‎‡a Author's Inhibition of miR-203 Reduces Spontaneous Recurrent Seizures in Mice‏
670 ‎‡a Author's Intrathecal-specific glutamic acid decarboxylase antibodies at low titers in autoimmune neurological disorders.‏
670 ‎‡a Author's Intravenous administration of human neural stem cells induces functional recovery in Huntington's disease rat model‏
670 ‎‡a Author's Isolated and prolonged loss of time orientation‏
670 ‎‡a Author's Let-7 microRNA inhibits the proliferation of human glioblastoma cells‏
670 ‎‡a Author's LGI1 expression and human brain asymmetry: insights from patients with LGI1-antibody encephalitis‏
670 ‎‡a Author's Light-induced amaurosis fugax due to severe distal internal carotid artery stenosis: in view of managing ocular ischemic syndrome.‏
670 ‎‡a Author's Loss of Pericytes in Radiation Necrosis after Glioblastoma Treatments.‏
670 ‎‡a Author's Maternal immune activation alters brain microRNA expression in mouse offspring‏
670 ‎‡a Author's Mefloquine improved progressive multifocal leukoencephalopathy in a patient with immunoglobulin A nephropathy‏
670 ‎‡a Author's Mega-dose phenobarbital therapy for super-refractory status epilepticus‏
670 ‎‡a Author's Memantine reduces hematoma expansion in experimental intracerebral hemorrhage, resulting in functional improvement‏
670 ‎‡a Author's Memantine reduces striatal cell death with decreasing calpain level in 3-nitropropionic model of Huntington's disease‏
670 ‎‡a Author's MicroRNAs induced during ischemic preconditioning‏
670 ‎‡a Author's miR-206 regulates brain-derived neurotrophic factor in Alzheimer disease model‏
670 ‎‡a Author's Modulation of mitochondrial function by stem cell-derived cellular components.‏
670 ‎‡a Author's MOG antibody-associated encephalitis in adult: clinical phenotypes and outcomes‏
670 ‎‡a Author's Molecular alterations underlying epileptogenesis after prolonged febrile seizure and modulation by erythropoietin.‏
670 ‎‡a Author's MR Imaging Analysis of Non-Measurable Enhancing Lesions Newly Appearing after Concomitant Chemoradiotherapy in Glioblastoma Patients for Prognosis Prediction‏
670 ‎‡a Author's Multidrug resistance protein 1 reduces the aggregation of mutant huntingtin in neuronal cells derived from the Huntington's disease R6/2 model‏
670 ‎‡a Author's Multipotent PDGFRβ-expressing cells in the circulation of stroke patients‏
670 ‎‡a Author's Neuro-Behcet's disease mimicking multiple brain tumors: diffusion-weighted MR study and literature review‏
670 ‎‡a Author's Neuropathologic and clinical features of human medial temporal lobe epilepsy.‏
670 ‎‡a Author's Neuroprotective effect of a cell-free extract derived from human adipose stem cells in experimental stroke models‏
670 ‎‡a Author's Neuroprotective effect of neural stem cell-conditioned media in in vitro model of Huntington's disease‏
670 ‎‡a Author's Neurotoxic syndrome developed after taking sertraline and risperidone‏
670 ‎‡a Author's Neurovascular Cell Sheet Transplantation in a Canine Model of Intracranial Hemorrhage‏
670 ‎‡a Author's New Concept of Neural Stem Cell Transplantation: Anti-inflammatory Role.‏
670 ‎‡a Author's New feasible treatment for refractory autoimmune encephalitis: Low-dose interleukin-2.‏
670 ‎‡a Author's Non-stiff anti-amphiphysin syndrome: clinical manifestations and outcome after immunotherapy‏
670 ‎‡a Author's Noninvasive method of immortalized neural stem-like cell transplantation in an experimental model of Huntington's disease‏
670 ‎‡a Author's Novel mutation in the ATL1 with autosomal dominant hereditary spastic paraplegia presented as dysautonomia.‏
670 ‎‡a Author's Novel recursive partitioning analysis classification for newly diagnosed glioblastoma: A multi-institutional study highlighting the MGMT promoter methylation and IDH1 gene mutation status‏
670 ‎‡a Author's NREM Sleep EEG Oscillations in Idiopathic REM Sleep Behavior Disorder: A study of sleep spindles and slow oscillations‏
670 ‎‡a Author's Nuclear localization of huntingtin during spermatogenesis‏
670 ‎‡a Author's Orthostatic intolerance symptoms are associated with depression and diminished quality of life in patients with postural tachycardia syndrome‏
670 ‎‡a Author's Panax ginseng enhances cognitive performance in Alzheimer disease.‏
670 ‎‡a Author's Paradoxical Choroid Plexitis during Treatment for Tuberculous Meningoencephalitis‏
670 ‎‡a Author's Periodicity of cerebral flow velocity during sleep and its association with white-matter hyperintensity volume‏
670 ‎‡a Author's Peroxisome proliferator-activated receptor-gamma-agonist, rosiglitazone, promotes angiogenesis after focal cerebral ischemia‏
670 ‎‡a Author's Pharmacological induction of heat shock protein exerts neuroprotective effects in experimental intracerebral hemorrhage‏
670 ‎‡a Author's Pharmacological Induction of Ischemic Tolerance by Glutamate Transporter-1‏
670 ‎‡a Author's Pharmacological Induction of Ischemic Tolerance by Glutamate Transporter-1 (EAAT2) Upregulation‏
670 ‎‡a Author's Pharmacological Treatment of Epilepsy in Elderly Patients‏
670 ‎‡a Author's Pneumonia in hospitalized neurologic patients: trends in pathogen distribution and antibiotic susceptibility‏
670 ‎‡a Author's Population pharmacokinetics and dose-response relationship of levetiracetam in adult patients with epilepsy‏
670 ‎‡a Author's Possible epigenetic regulatory effect of dysregulated circular RNAs in Alzheimer's disease model‏
670 ‎‡a Author's Possible epigenetic regulatory effect of dysregulated circular RNAs in epilepsy‏
670 ‎‡a Author's Predictors of survival for patients with cancer after cryptogenic stroke‏
670 ‎‡a Author's Prevalence of antineuronal antibodies in patients with encephalopathy of unknown etiology: Data from a nationwide registry in Korea.‏
670 ‎‡a Author's Profiles of multidrug resistance protein-1 in the peripheral blood mononuclear cells of patients with refractory epilepsy‏
670 ‎‡a Author's Prognosis of spontaneous cervical artery dissection and transcranial Doppler findings associated with clinical outcomes‏
670 ‎‡a Author's Prognosis prediction of non-enhancing T2 high signal intensity lesions in glioblastoma patients after standard treatment: application of dynamic contrast-enhanced MR imaging.‏
670 ‎‡a Author's Prognostic Predictions for Patients with Glioblastoma after Standard Treatment: Application of Contrast Leakage Information from DSC-MRI within Nonenhancing FLAIR High-Signal-Intensity Lesions‏
670 ‎‡a Author's Prognostic Value of Initial Standard EEG and MRI in Patients with Herpes Simplex Encephalitis‏
670 ‎‡a Author's Progression of Cerebral White Matter Hyperintensities and the Associated Sonographic Index‏
670 ‎‡a Author's Prolonged-release melatonin in patients with idiopathic REM sleep behavior disorder‏
670 ‎‡a Author's Proteasomal inhibition in intracerebral hemorrhage: neuroprotective and anti-inflammatory effects of bortezomib‏
670 ‎‡a Author's Psychiatric symptoms delay the diagnosis of anti-LGI1 encephalitis.‏
670 ‎‡a Author's Quantification of human neural stem cell engraftments in rat brains using ERV-3 real-time PCR.‏
670 ‎‡a Author's Radiogenomics correlation between MR imaging features and major genetic profiles in glioblastoma.‏
670 ‎‡a Author's Rapid diagnosis of bacterial meningitis by nanopore 16S amplicon sequencing: A pilot study‏
670 ‎‡a Author's Reduced P300 amplitude during a visuospatial attention task in idiopathic rapid eye movement sleep behavior disorder.‏
670 ‎‡a Author's Reemergence of Japanese Encephalitis in South Korea, 2010–2015‏
670 ‎‡a Author's Refining General Principles of Antiepileptic Drug Treatments for Epilepsy‏
670 ‎‡a Author's Region-specific plasticity in the epileptic rat brain: a hippocampal and extrahippocampal analysis‏
670 ‎‡a Author's Reply to "Grading the severity of autoimmune encephalitis: Advances and pitfalls" ‏
670 ‎‡a Author's Reply to "Grading the Severity of Autoimmune Encephalitis: When to Evaluate?" ‏
670 ‎‡a Author's Rhythmical Photic Stimulation at Alpha Frequencies Produces Antidepressant-Like Effects in a Mouse Model of Depression‏
670 ‎‡a Author's Risk of macrovascular complications in type 2 diabetes mellitus: endothelial microparticle profiles‏
670 ‎‡a Author's Rituximab treatment for autoimmune limbic encephalitis in an institutional cohort‏
670 ‎‡a Author's Rituximab Treatment for Idiopathic Hypertrophic Pachymeningitis‏
670 ‎‡a Author's Role of cortical dysplasia in epileptogenesis following prolonged febrile seizure‏
670 ‎‡a Author's Safety of tianeptine use in patients with epilepsy‏
670 ‎‡a Author's Screening of the A11084G Polymorphism and Scanning of a Mitochondrial Genome SNP in Korean Migraineurs‏
670 ‎‡a Author's Seronegative autoimmune encephalitis: clinical characteristics and factors associated with outcomes‏
670 ‎‡a Author's Site-Specific Relationship Between Intracranial Aneurysm and Aortic Aneurysm‏
670 ‎‡a Author's Slowed progression in models of Huntington disease by adipose stem cell transplantation‏
670 ‎‡a Author's Soluble mediators from human neural stem cells play a critical role in suppression of T-cell activation and proliferation.‏
670 ‎‡a Author's Sonographic findings associated with stenosis progression and vascular complications in moyamoya disease.‏
670 ‎‡a Author's Stem cell-based cell therapy for Huntington disease: a review‏
670 ‎‡a Author's Stem Cells Transplantation and Huntington's Disease‏
670 ‎‡a Author's Stroke mimicking encephalopathy as an initial manifestation of diffuse large B-cell lymphoma‏
670 ‎‡a Author's Successful Treatment of Refractory Dyskinesia Secondary to Anti-N-Methyl-D-Aspartate Receptor Encephalitis With Electroconvulsive Therapy‏
670 ‎‡a Author's Sun ginseng protects endothelial progenitor cells from senescence associated apoptosis‏
670 ‎‡a Author's Survival gain with re-Op/RT for recurred high-grade gliomas depends upon risk groups‏
670 ‎‡a Author's Switching between phenytoin generics in patients with epilepsy may lead to increased risk of breakthrough seizure: chart analysis and practice recommendations‏
670 ‎‡a Author's Systemic transplantation of human adipose stem cells attenuated cerebral inflammation and degeneration in a hemorrhagic stroke model.‏
670 ‎‡a Author's The c-Abl inhibitor, nilotinib, as a potential therapeutic agent for chronic cerebellar ataxia‏
670 ‎‡a Author's The complexity of diagnosing postural orthostatic tachycardia syndrome: influence of the diurnal variability.‏
670 ‎‡a Author's The effect of dim light at night on cerebral hemodynamic oscillations during sleep: A near-infrared spectroscopy study‏
670 ‎‡a Author's The Effect of Paroxetine on the Reduction of Migraine Frequency is Independent of Its Anxiolytic Effect‏
670 ‎‡a Author's The efficacy of combined estrogen and buspirone treatment in olivopontocerebellar atrophy‏
670 ‎‡a Author's The HLA-A*2402/Cw*0102 haplotype is associated with lamotrigine-induced maculopapular eruption in the Korean population‏
670 ‎‡a Author's The long-term efficacy and safety of levetiracetam in a tertiary epilepsy centre‏
670 ‎‡a Author's Three-Year Retention Rates of Levetiracetam, Topiramate, and Oxcarbazepine: A Retrospective Hospital-Based Study‏
670 ‎‡a Author's Tocilizumab in Autoimmune Encephalitis Refractory to Rituximab: An Institutional Cohort Study.‏
670 ‎‡a Author's Tocilizumab treatment for new-onset refractory status epilepticus‏
670 ‎‡a Author's Tolerability of lacosamide rapid dose titration: A randomized, multicenter, prospective, open-label study‏
670 ‎‡a Author's Tolerated nitrite therapy in experimental intracerebral hemorrhage: Rationale of nitrite therapy in a broad range of hyperacute strokes.‏
670 ‎‡a Author's Topiramate increases the risk of valproic acid-induced encephalopathy‏
670 ‎‡a Author's Transplantation of human neural stem cells protect against ischemia in a preventive mode via hypoxia-inducible factor-1 Alpha stabilization in the host brain‏
670 ‎‡a Author's Transplantation of patient-derived adipose stem cells in YAC128 Huntington's disease transgenic mice‏
670 ‎‡a Author's Treatment strategies for autoimmune encephalitis‏
670 ‎‡a Author's Underexpression of HOXA11 Is Associated with Treatment Resistance and Poor Prognosis in Glioblastoma‏
670 ‎‡a Author's Unfavorable surgical outcomes in partial epilepsy with secondary bilateral synchrony: Intracranial electroencephalography study.‏
670 ‎‡a Author's Unique behavioral characteristics and microRNA signatures in a drug resistant epilepsy model‏
670 ‎‡a Author's Usefulness of saliva for perampanel therapeutic drug monitoring‏
670 ‎‡a Author's Valproic acid-mediated neuroprotection in intracerebral hemorrhage via histone deacetylase inhibition and transcriptional activation.‏
670 ‎‡a Author's VGKC-complex/LGI1-antibody encephalitis: clinical manifestations and response to immunotherapy.‏
670 ‎‡a Author's White matter hyperintensities and cognitive dysfunction in Alzheimer disease‏
909 ‎‡a (scopus) 8527655300‏ ‎‡9 1‏
909 ‎‡a (orcid) 0000000347677564‏ ‎‡9 1‏
919 ‎‡a antiinflammatorymechanismofintravascularneuralstemcelltransplantationinhaemorrhagicstroke‏ ‎‡A Anti-inflammatory mechanism of intravascular neural stem cell transplantation in haemorrhagic stroke‏ ‎‡9 1‏
919 ‎‡a alterednetworkcharacteristicsofspikewavedischargesinjuvenilemyoclonicepilepsy‏ ‎‡A Altered Network Characteristics of Spike-Wave Discharges in Juvenile Myoclonic Epilepsy.‏ ‎‡9 1‏
919 ‎‡a alteredmicrornaregulationinhuntingtonsdiseasemodels‏ ‎‡A Altered microRNA regulation in Huntington's disease models‏ ‎‡9 1‏
919 ‎‡a alteredlongnoncodingrnaprofileafterintracerebralhemorrhage‏ ‎‡A Altered long noncoding RNA profile after intracerebral hemorrhage‏ ‎‡9 1‏
919 ‎‡a alteredfunctionalconnectivityinidiopathicrapideyemovementsleepbehaviordisorderarestingstateeegstudy‏ ‎‡A Altered Functional Connectivity in Idiopathic Rapid Eye Movement Sleep Behavior Disorder: A Resting-State EEG Study‏ ‎‡9 1‏
919 ‎‡a alteredexpressionofthelongnoncodingrnaneat1inhuntingtonsdisease‏ ‎‡A Altered Expression of the Long Noncoding RNA NEAT1 in Huntington's Disease.‏ ‎‡9 1‏
919 ‎‡a alteredexpressionofmir202incerebellumofmultiplesystematrophy‏ ‎‡A Altered expression of miR-202 in cerebellum of multiple-system atrophy‏ ‎‡9 1‏
919 ‎‡a alteredbehaviorandneuralactivityinconspecificcagematescohousedwithmousemodelsofbraindisorders‏ ‎‡A Altered behavior and neural activity in conspecific cagemates co-housed with mouse models of brain disorders‏ ‎‡9 1‏
919 ‎‡a acutesymptomaticbasilararterystenosismrimagingpredictorsofearlyneurologicdeteriorationandlongtermoutcomes‏ ‎‡A Acute Symptomatic Basilar Artery Stenosis: MR Imaging Predictors of Early Neurologic Deterioration and Long-term Outcomes‏ ‎‡9 1‏
919 ‎‡a acquiredencephalopathyassociatedwithcarnitinedeficiencyaftercefditorenpivoxiladministration‏ ‎‡A Acquired encephalopathy associated with carnitine deficiency after cefditoren pivoxil administration‏ ‎‡9 1‏
919 ‎‡a abnormalactivationofmotorcorticalnetworkduringphasicremsleepinidiopathicremsleepbehaviordisorder‏ ‎‡A Abnormal activation of motor cortical network during phasic REM sleep in idiopathic REM sleep behavior disorder‏ ‎‡9 1‏
919 ‎‡a novelindicatorthejinxsignisassociatedwithanalteredfrontalbasalganglionicconnection‏ ‎‡A A novel indicator, the "Jinx sign," is associated with an altered frontal-basal ganglionic connection‏ ‎‡9 1‏
919 ‎‡a cellfreeextractfromhumanadiposestemcellsprotectsmiceagainstepilepsy‏ ‎‡A A cell-free extract from human adipose stem cells protects mice against epilepsy‏ ‎‡9 1‏
919 ‎‡a antilgi1encephalitisisassociatedwithuniquehlasubtypes‏ ‎‡A Anti-LGI1 encephalitis is associated with unique HLA subtypes.‏ ‎‡9 1‏
919 ‎‡a antilgi1limbicencephalitispresentedwithatypicalmanifestations‏ ‎‡A Anti-LGI1 Limbic Encephalitis Presented with Atypical Manifestations‏ ‎‡9 1‏
919 ‎‡a antinmethyl500aspartatereceptorencephalitisinkoreaclinicalfeaturestreatmentandoutcome‏ ‎‡A Anti-N-methyl-d-aspartate receptor encephalitis in Korea: clinical features, treatment, and outcome‏ ‎‡9 1‏
919 ‎‡a antiepilepticdrugselectionaccordingtoseizuretypeinadultpatientswithepilepsy‏ ‎‡A Antiepileptic Drug Selection According to Seizure Type in Adult Patients with Epilepsy‏ ‎‡9 1‏
919 ‎‡a associationofbloodpressurevariabilitywithorthostaticintolerancesymptoms‏ ‎‡A Association of blood pressure variability with orthostatic intolerance symptoms.‏ ‎‡9 1‏
919 ‎‡a associationofbonemineraldensitywiththeriskofintracranialaneurysm‏ ‎‡A Association of Bone Mineral Density With the Risk of Intracranial Aneurysm‏ ‎‡9 1‏
919 ‎‡a associationofcardiachemodynamicfactorswithseverityofwhitematterhyperintensitiesinchronicvalvularheartdisease‏ ‎‡A Association of Cardiac Hemodynamic Factors With Severity of White Matter Hyperintensities in Chronic Valvular Heart Disease‏ ‎‡9 1‏
919 ‎‡a atherosclerosisrelatedcirculatingmicrornasasapredictorofstrokerecurrence‏ ‎‡A Atherosclerosis-Related Circulating MicroRNAs as a Predictor of Stroke Recurrence‏ ‎‡9 1‏
919 ‎‡a atorvastatinattenuatesmitochondrialtoxininducedstriataldegenerationwithdecreasinginos100junlevelsandactivatingerkaktpathways‏ ‎‡A Atorvastatin attenuates mitochondrial toxin-induced striatal degeneration, with decreasing iNOS/c-Jun levels and activating ERK/Akt pathways‏ ‎‡9 1‏
919 ‎‡a augmentationofnitritetherapyincerebralischemiabynmdareceptorinhibition‏ ‎‡A Augmentation of nitrite therapy in cerebral ischemia by NMDA receptor inhibition‏ ‎‡9 1‏
919 ‎‡a autophagyisinvolvedintheischemicpreconditioning‏ ‎‡A Autophagy is involved in the ischemic preconditioning‏ ‎‡9 1‏
919 ‎‡a blockadeofat1receptorreducesapoptosisinflammationandoxidativestressinnormotensiveratswithintracerebralhemorrhage‏ ‎‡A Blockade of AT1 receptor reduces apoptosis, inflammation, and oxidative stress in normotensive rats with intracerebral hemorrhage‏ ‎‡9 1‏
919 ‎‡a bortezomibtreatmentforsevererefractoryantinmdareceptorencephalitis‏ ‎‡A Bortezomib treatment for severe refractory anti-NMDA receptor encephalitis.‏ ‎‡9 1‏
919 ‎‡a brainresponsecharacteristicsassociatedwithsubclavianstealphenomenon‏ ‎‡A Brain response characteristics associated with subclavian steal phenomenon.‏ ‎‡9 1‏
919 ‎‡a brainstemencephalitiscausedbycoxiellaburnetii‏ ‎‡A Brainstem encephalitis caused by Coxiella burnetii‏ ‎‡9 1‏
919 ‎‡a brightlightexposurebeforebedtimeimpairsresponseinhibitionthefollowingmorninganonrandomizedcrossoverstudy‏ ‎‡A Bright light exposure before bedtime impairs response inhibition the following morning: a non-randomized crossover study.‏ ‎‡9 1‏
919 ‎‡a 100cblregulatesαpixmediatedcellmigrationandinvasion‏ ‎‡A c-Cbl regulates αPix-mediated cell migration and invasion.‏ ‎‡9 1‏
919 ‎‡a casub5subα2δautoimmuneencephalitisanovelantibodyanditscharacteristics‏ ‎‡A Ca<sub>V</sub> α2δ Autoimmune Encephalitis: A Novel Antibody and its Characteristics‏ ‎‡9 1‏
919 ‎‡a campylobacterfetusmeningitisconfirmedbya16srrnageneanalysisusingtheminionnanoporesequencersouthkorea‏ ‎‡A Campylobacter fetus meningitis confirmed by a 16S rRNA gene analysis using the MinION nanopore sequencer, South Korea, 2016.‏ ‎‡9 1‏
919 ‎‡a capabilityofarterialspinlabelingmrimaginginlocalizingseizurefocusinclinicalseizureactivity‏ ‎‡A Capability of arterial spin labeling MR imaging in localizing seizure focus in clinical seizure activity‏ ‎‡9 1‏
919 ‎‡a cardiacsympatheticdysfunctioninantinmdareceptorencephalitis‏ ‎‡A Cardiac sympathetic dysfunction in anti-NMDA receptor encephalitis‏ ‎‡9 1‏
919 ‎‡a caseofrickettsiatyphiinducedbrainabscessmimickingbraintumor‏ ‎‡A Case of Rickettsia typhi-induced Brain Abscess Mimicking Brain Tumor.‏ ‎‡9 1‏
919 ‎‡a celecoxibinducesfunctionalrecoveryafterintracerebralhemorrhagewithreductionofbrainedemaandperihematomalcelldeath‏ ‎‡A Celecoxib induces functional recovery after intracerebral hemorrhage with reduction of brain edema and perihematomal cell death‏ ‎‡9 1‏
919 ‎‡a cellproliferationandsynaptogenesisinthecerebellumafterfocalcerebralischemia‏ ‎‡A Cell proliferation and synaptogenesis in the cerebellum after focal cerebral ischemia.‏ ‎‡9 1‏
919 ‎‡a centralnervoussystemcomplicationsafterlivertransplantation‏ ‎‡A Central nervous system complications after liver transplantation.‏ ‎‡9 1‏
919 ‎‡a centralnervoussysteminfectionassociatedwithorientiatsutsugamushiinsouthkorea‏ ‎‡A Central Nervous System Infection Associated with Orientia tsutsugamushi in South Korea.‏ ‎‡9 1‏
919 ‎‡a cerebralautoinflammatorydiseasetreatedwithanakinra‏ ‎‡A Cerebral autoinflammatory disease treated with anakinra.‏ ‎‡9 1‏
919 ‎‡a changeofpatientselectionstrategyandimprovedsurgicaloutcomeinmrinegativeneocorticalepilepsy‏ ‎‡A Change of Patient Selection Strategy and Improved Surgical Outcome in MRI-negative Neocortical Epilepsy‏ ‎‡9 1‏
919 ‎‡a characteristicsofepilepsypatientswhocommittedviolentcrimesreportfromthenationalforensichospital‏ ‎‡A Characteristics of Epilepsy Patients who Committed Violent Crimes: Report from the National Forensic Hospital‏ ‎‡9 1‏
919 ‎‡a cholinergicantiinflammatorypathwayinintracerebralhemorrhage‏ ‎‡A Cholinergic anti-inflammatory pathway in intracerebral hemorrhage‏ ‎‡9 1‏
919 ‎‡a circulatingcd62e+microparticlesandcardiovascularoutcomes‏ ‎‡A Circulating CD62E+ microparticles and cardiovascular outcomes‏ ‎‡9 1‏
919 ‎‡a circulatingendothelialmicroparticlesasamarkerofcerebrovasculardisease‏ ‎‡A Circulating endothelial microparticles as a marker of cerebrovascular disease.‏ ‎‡9 1‏
919 ‎‡a circulatingendothelialprogenitorcellsasanewmarkerofendothelialdysfunctionorrepairinacutestroke‏ ‎‡A Circulating endothelial progenitor cells as a new marker of endothelial dysfunction or repair in acute stroke‏ ‎‡9 1‏
919 ‎‡a circulatingendothelialprogenitorcellsasapathogeneticmarkerofmoyamoyadisease‏ ‎‡A Circulating endothelial progenitor cells as a pathogenetic marker of moyamoya disease‏ ‎‡9 1‏
919 ‎‡a clinicalandangiographicfactorsrelatedtotheprognosisofcavernoussinusduralarteriovenousfistula‏ ‎‡A Clinical and angiographic factors related to the prognosis of cavernous sinus dural arteriovenous fistula‏ ‎‡9 1‏
919 ‎‡a clinicalapplicationsofsimultaneouspetmrimagingusingrverapamilwithcyclosporinapreliminaryresultsonasurrogatemarkerofdrugresistantepilepsy‏ ‎‡A Clinical Applications of Simultaneous PET/MR Imaging Using (R)-[11C]-Verapamil with Cyclosporin A: Preliminary Results on a Surrogate Marker of Drug-Resistant Epilepsy.‏ ‎‡9 1‏
919 ‎‡a clinicalapproachtoautoimmuneepilepsy‏ ‎‡A Clinical Approach to Autoimmune Epilepsy‏ ‎‡9 1‏
919 ‎‡a clinicalcharacteristicsofseverejapaneseencephalitisacaseseriesfromsouthkorea‏ ‎‡A Clinical Characteristics of Severe Japanese Encephalitis: A Case Series from South Korea.‏ ‎‡9 1‏
919 ‎‡a clinicalcharacterizationofunknowncryptogenicstatusepilepticussuspectedasencephalitisamulticentercohortstudy‏ ‎‡A Clinical characterization of unknown/cryptogenic status epilepticus suspected as encephalitis: A multicenter cohort study.‏ ‎‡9 1‏
919 ‎‡a clinicalmanifestationofcancerrelatedstrokeretrospectivecasecontrolstudy‏ ‎‡A Clinical manifestation of cancer related stroke: retrospective case-control study‏ ‎‡9 1‏
919 ‎‡a clinicalmanifestationsandoutcomesofthetreatmentofpatientswithgababencephalitis‏ ‎‡A Clinical manifestations and outcomes of the treatment of patients with GABAB encephalitis‏ ‎‡9 1‏
919 ‎‡a clinicalmanifestationsandtreatmentoutcomesofparvovirusb19encephalitisinimmunocompetentadults‏ ‎‡A Clinical manifestations and treatment outcomes of parvovirus B19 encephalitis in immunocompetent adults.‏ ‎‡9 1‏
919 ‎‡a clinicalmanifestationsofpatientswithcaspr2antibodies‏ ‎‡A Clinical manifestations of patients with CASPR2 antibodies.‏ ‎‡9 1‏
919 ‎‡a clinicalobservationoflymphopeniainpatientswithnewlydiagnosedglioblastoma‏ ‎‡A Clinical observation of lymphopenia in patients with newly diagnosed glioblastoma‏ ‎‡9 1‏
919 ‎‡a clusteringofspontaneousrecurrentseizuresseparatedbylongseizurefreeperiodsanextendedvideoeegmonitoringstudyofapilocarpinemousemodel‏ ‎‡A Clustering of spontaneous recurrent seizures separated by long seizure-free periods: An extended video-EEG monitoring study of a pilocarpine mouse model.‏ ‎‡9 1‏
919 ‎‡a combinedneuroprotectiveeffectsofcelecoxibandmemantineinexperimentalintracerebralhemorrhage‏ ‎‡A Combined neuroprotective effects of celecoxib and memantine in experimental intracerebral hemorrhage‏ ‎‡9 1‏
919 ‎‡a combinedtreatmentofvascularendothelialgrowthfactorandhumanneuralstemcellsinexperimentalfocalcerebralischemia‏ ‎‡A Combined treatment of vascular endothelial growth factor and human neural stem cells in experimental focal cerebral ischemia‏ ‎‡9 1‏
919 ‎‡a comorbiddepressionisassociatedwithanegativetreatmentresponseinidiopathicremsleepbehaviordisorder‏ ‎‡A Comorbid Depression Is Associated with a Negative Treatment Response in Idiopathic REM Sleep Behavior Disorder‏ ‎‡9 1‏
919 ‎‡a comparisonofgeneticprofilesandprognosisofhighgradegliomasusingquantitativeandqualitativemrifeaturesafocusong3gliomas‏ ‎‡A Comparison of Genetic Profiles and Prognosis of High-Grade Gliomas Using Quantitative and Qualitative MRI Features: A Focus on G3 Gliomas‏ ‎‡9 1‏
919 ‎‡a continuouscytosineb500arabinofuranosideinfusionreducesectopicgranulecellsinadultrathippocampuswithattenuationofspontaneousrecurrentseizuresfollowingpilocarpineinducedstatusepilepticus‏ ‎‡A Continuous cytosine-b-D-arabinofuranoside infusion reduces ectopic granule cells in adult rat hippocampus with attenuation of spontaneous recurrent seizures following pilocarpine-induced status epilepticus‏ ‎‡9 1‏
919 ‎‡a correctionclusteringofspontaneousrecurrentseizuresseparatedbylongseizurefreeperiodsanextendedvideoeegmonitoringstudyofapilocarpinemousemodel‏ ‎‡A Correction: Clustering of spontaneous recurrent seizures separated by long seizure-free periods: An extended video-EEG monitoring study of a pilocarpine mouse model‏ ‎‡9 1‏
919 ‎‡a correctiondirectgenerationofneurospherelikecellsfromhumandermalfibroblasts‏ ‎‡A Correction: Direct Generation of Neurosphere-Like Cells from Human Dermal Fibroblasts‏ ‎‡9 1‏
919 ‎‡a corrigendumtoalteredrestingstatethalamooccipitalfunctionalconnectivityisassociatedwithcognitioninisolatedrapideyemovementsleepbehaviordisorder‏ ‎‡A Corrigendum to "Altered resting-state thalamo-occipital functional connectivity is associated with cognition in isolated rapid eye movement sleep behavior disorder" [Sleep Med 69 (2020) 198-203]‏ ‎‡9 1‏
919 ‎‡a criminalmanifestationsofdementiapatientsreportfromthenationalforensichospital‏ ‎‡A Criminal manifestations of dementia patients: report from the national forensic hospital‏ ‎‡9 1‏
919 ‎‡a cyclooxygenase2inhibitorcelecoxibinhibitsthealteredhippocampalneurogenesiswithattenuationofspontaneousrecurrentseizuresfollowingpilocarpineinducedstatusepilepticus‏ ‎‡A Cyclooxygenase-2 inhibitor, celecoxib, inhibits the altered hippocampal neurogenesis with attenuation of spontaneous recurrent seizures following pilocarpine-induced status epilepticus‏ ‎‡9 1‏
919 ‎‡a cystatin100apotentialmarkerforcerebralmicrovascularcomplianceisassociatedwithwhitematterhyperintensitiesprogression‏ ‎‡A Cystatin C, a potential marker for cerebral microvascular compliance, is associated with white-matter hyperintensities progression.‏ ‎‡9 1‏
919 ‎‡a delayedorthostatichypotensionseverityofclinicalsymptomsandresponsetomedicaltreatment‏ ‎‡A Delayed orthostatic hypotension: Severity of clinical symptoms and response to medical treatment‏ ‎‡9 1‏
919 ‎‡a deleterious100cblexonskippingcontributestohumanglioma‏ ‎‡A Deleterious c-Cbl Exon Skipping Contributes to Human Glioma.‏ ‎‡9 1‏
919 ‎‡a depletionofnervegrowthfactorinchemotherapyinducedperipheralneuropathyassociatedwithhematologicmalignancies‏ ‎‡A Depletion of nerve growth factor in chemotherapy-induced peripheral neuropathy associated with hematologic malignancies‏ ‎‡9 1‏
919 ‎‡a developmentoflgi1antibodyencephalitisaftertreatmentoflungcancer‏ ‎‡A Development of LGI1 antibody encephalitis after treatment of lung cancer‏ ‎‡9 1‏
919 ‎‡a developmentoftheclinicalassessmentscaleinautoimmuneencephalitis‏ ‎‡A Development of the clinical assessment scale in autoimmune encephalitis‏ ‎‡9 1‏
919 ‎‡a diagnosisofhaemophilusinfluenzaepneumoniabynanopore16sampliconsequencingofsputum‏ ‎‡A Diagnosis of Haemophilus influenzae Pneumonia by Nanopore 16S Amplicon Sequencing of Sputum‏ ‎‡9 1‏
919 ‎‡a differentiationofhighgradefromlowgradeastrocytomaimprovementindiagnosticaccuracyandreliabilityofpharmacokineticparametersfromdcemrimagingbyusingarterialinputfunctionsobtainedfromdscmrimaging‏ ‎‡A Differentiation of High-Grade from Low-Grade Astrocytoma: Improvement in Diagnostic Accuracy and Reliability of Pharmacokinetic Parameters from DCE MR Imaging by Using Arterial Input Functions Obtained from DSC MR Imaging.‏ ‎‡9 1‏
919 ‎‡a directgenerationofneurospherelikecellsfromhumandermalfibroblasts‏ ‎‡A Direct generation of neurosphere-like cells from human dermal fibroblasts‏ ‎‡9 1‏
919 ‎‡a distinctexpressionoflongnoncodingrnasinanalzheimersdiseasemodel‏ ‎‡A Distinct Expression of Long Non-Coding RNAs in an Alzheimer's Disease Model.‏ ‎‡9 1‏
919 ‎‡a distinctintrathecalinterleukin17interleukin6activationinantinmethyl500aspartatereceptorencephalitis‏ ‎‡A Distinct intrathecal interleukin-17/interleukin-6 activation in anti-N-methyl-d-aspartate receptor encephalitis.‏ ‎‡9 1‏
919 ‎‡a dynamiccontrastenhancedmrimaginginpredictingprogressionofenhancinglesionspersistingafterstandardtreatmentinglioblastomapatientsaprospectivestudy‏ ‎‡A Dynamic contrast-enhanced MR imaging in predicting progression of enhancing lesions persisting after standard treatment in glioblastoma patients: a prospective study.‏ ‎‡9 1‏
919 ‎‡a dynamiccontrastenhancedmrimagingofnonenhancingt2highsignalintensitylesionsinbaselineandposttreatmentglioblastomatemporalchangeandprognosticvalue‏ ‎‡A Dynamic Contrast-Enhanced MR Imaging of Nonenhancing T2 High-Signal-Intensity Lesions in Baseline and Posttreatment Glioblastoma: Temporal Change and Prognostic Value‏ ‎‡9 1‏
919 ‎‡a dysfunctionalcharacteristicsofcirculatingangiogeniccellsinalzheimersdisease‏ ‎‡A Dysfunctional characteristics of circulating angiogenic cells in Alzheimer's disease.‏ ‎‡9 1‏
919 ‎‡a dysregulatedlongnoncodingrnasinthetemporallobeepilepsymousemodel‏ ‎‡A Dysregulated long non-coding RNAs in the temporal lobe epilepsy mouse model.‏ ‎‡9 1‏
919 ‎‡a dysregulationoflongnoncodingrnasinmousemodelsoflocalizationrelatedepilepsy‏ ‎‡A Dysregulation of long non-coding RNAs in mouse models of localization-related epilepsy.‏ ‎‡9 1‏
919 ‎‡a earlydiagnosisofalzheimersdiseasefromelevatedolfactorymucosalmir206level‏ ‎‡A Early diagnosis of Alzheimer's disease from elevated olfactory mucosal miR-206 level.‏ ‎‡9 1‏
919 ‎‡a earlyintravenousinfusionofsodiumnitriteprotectsbrainagainstinvivoischemiareperfusioninjury‏ ‎‡A Early intravenous infusion of sodium nitrite protects brain against in vivo ischemia-reperfusion injury‏ ‎‡9 1‏
919 ‎‡a echocardiographicevidenceofinnateaortopathyinthehumanintracranialaneurysm‏ ‎‡A Echocardiographic evidence of innate aortopathy in the human intracranial aneurysm‏ ‎‡9 1‏
919 ‎‡a echocardiographicindexeeinassociationwithcerebralwhitematterhyperintensityprogression‏ ‎‡A Echocardiographic index E/e' in association with cerebral white matter hyperintensity progression‏ ‎‡9 1‏
919 ‎‡a effectofimmunotherapyonseizureoutcomeinpatientswithautoimmuneencephalitisaprospectiveobservationalregistrystudy‏ ‎‡A Effect of Immunotherapy on Seizure Outcome in Patients with Autoimmune Encephalitis: A Prospective Observational Registry Study‏ ‎‡9 1‏
919 ‎‡a effectsoflongtermnitritetherapyonfunctionalrecoveryinexperimentalischemiamodel‏ ‎‡A Effects of long term nitrite therapy on functional recovery in experimental ischemia model.‏ ‎‡9 1‏
919 ‎‡a efficacyofatomoxetineversusmidodrineforneurogenicorthostatichypotension‏ ‎‡A Efficacy of atomoxetine versus midodrine for neurogenic orthostatic hypotension‏ ‎‡9 1‏
919 ‎‡a efficacyofpropranololbisoprololandpyridostigmineforposturaltachycardiasyndromearandomizedclinicaltrial‏ ‎‡A Efficacy of Propranolol, Bisoprolol, and Pyridostigmine for Postural Tachycardia Syndrome: a Randomized Clinical Trial.‏ ‎‡9 1‏
919 ‎‡a efficacyofsingleorcombinedmidodrineandpyridostigmineinorthostatichypotension‏ ‎‡A Efficacy of single or combined midodrine and pyridostigmine in orthostatic hypotension‏ ‎‡9 1‏
919 ‎‡a erratumtolossofpericytesinradiationnecrosisafterglioblastomatreatments‏ ‎‡A Erratum to: Loss of Pericytes in Radiation Necrosis after Glioblastoma Treatments.‏ ‎‡9 1‏
919 ‎‡a erythropoietinimprovesmemoryfunctionwithreducingendothelialdysfunctionandamyloidbetaburdeninalzheimersdiseasemodels‏ ‎‡A Erythropoietin improves memory function with reducing endothelial dysfunction and amyloid-beta burden in Alzheimer's disease models‏ ‎‡9 1‏
919 ‎‡a erythropoietinreducesepileptogenicprocessesfollowingstatusepilepticus‏ ‎‡A Erythropoietin reduces epileptogenic processes following status epilepticus‏ ‎‡9 1‏
919 ‎‡a erythropoietinreducesperihematomalinflammationandcelldeathwithenosandstat3activationsinexperimentalintracerebralhemorrhage‏ ‎‡A Erythropoietin reduces perihematomal inflammation and cell death with eNOS and STAT3 activations in experimental intracerebral hemorrhage‏ ‎‡9 1‏
919 ‎‡a etiologyandprognosisofnonconvulsivestatusepilepticus‏ ‎‡A Etiology and prognosis of non-convulsive status epilepticus‏ ‎‡9 1‏
919 ‎‡a exosomebaseddeliveryofmir124inahuntingtonsdiseasemodel‏ ‎‡A Exosome-Based Delivery of miR-124 in a Huntington's Disease Model‏ ‎‡9 1‏
919 ‎‡a experimentalinductionofcerebralaneurysmsbydevelopmentallowcopperdiet‏ ‎‡A Experimental Induction of Cerebral Aneurysms by Developmental Low Copper Diet‏ ‎‡9 1‏
919 ‎‡a extractsofadiposederivedstemcellsslowsprogressioninther62modelofhuntingtonsdisease‏ ‎‡A Extracts of adipose derived stem cells slows progression in the R6/2 model of Huntington's disease‏ ‎‡9 1‏
919 ‎‡a fatalfamilialinsomniapresentingwithagrypniaexcitataandverylowatoniaindexlevelacasereportandliteraturereview‏ ‎‡A Fatal familial insomnia presenting with agrypnia excitata and very low atonia index level: A case report and literature review‏ ‎‡9 1‏
919 ‎‡a feasibilityandsafetyofintraarterialpericyteprogenitorcelldeliveryfollowingmannitolinducedtransientbloodbrainbarrieropeninginacaninemodel‏ ‎‡A Feasibility and Safety of Intra-arterial Pericyte Progenitor Cell Delivery Following Mannitol-Induced Transient Blood-Brain Barrier Opening in a Canine Model‏ ‎‡9 1‏
919 ‎‡a frequencyofandriskfactorsforoxcarbazepineinducedsevereandsymptomatichyponatremia‏ ‎‡A Frequency of and risk factors for oxcarbazepine-induced severe and symptomatic hyponatremia‏ ‎‡9 1‏
919 ‎‡a frequentrhabdomyolysisinantinmdareceptorencephalitis‏ ‎‡A Frequent rhabdomyolysis in anti-NMDA receptor encephalitis‏ ‎‡9 1‏
919 ‎‡a gcsfprotectshumancerebralhybridneuronsagainstinvitroischemia‏ ‎‡A G-CSF protects human cerebral hybrid neurons against in vitro ischemia‏ ‎‡9 1‏
919 ‎‡a galantaminereducesstriataldegenerationin3nitropropionicacidmodelofhuntingtonsdisease‏ ‎‡A Galantamine reduces striatal degeneration in 3-nitropropionic acid model of Huntington's disease.‏ ‎‡9 1‏
919 ‎‡a gammaoscillationinfunctionalbrainnetworksisinvolvedinthespontaneousremissionofdepressivebehaviorinducedbychronicrestraintstressinmice‏ ‎‡A Gamma oscillation in functional brain networks is involved in the spontaneous remission of depressive behavior induced by chronic restraint stress in mice‏ ‎‡9 1‏
919 ‎‡a granulocytecolonystimulatingfactorattenuatesstriataldegenerationwithactivatingsurvivalpathwaysin3nitropropionicacidmodelofhuntingtonsdisease‏ ‎‡A Granulocyte-colony stimulating factor attenuates striatal degeneration with activating survival pathways in 3-nitropropionic acid model of Huntington's disease‏ ‎‡9 1‏
919 ‎‡a granulocytecolonystimulatingfactorenhancesangiogenesisafterfocalcerebralischemia‏ ‎‡A Granulocyte colony-stimulating factor enhances angiogenesis after focal cerebral ischemia‏ ‎‡9 1‏
919 ‎‡a granulocytecolonystimulatingfactorinducessensorimotorrecoveryinintracerebralhemorrhage‏ ‎‡A Granulocyte colony-stimulating factor induces sensorimotor recovery in intracerebral hemorrhage‏ ‎‡9 1‏
919 ‎‡a granulocytecolonystimulatingfactorstimulatesneurogenesisviavascularendothelialgrowthfactorwithstatactivation‏ ‎‡A Granulocyte colony-stimulating factor stimulates neurogenesis via vascular endothelial growth factor with STAT activation‏ ‎‡9 1‏
919 ‎‡a heatprocessedginsengenhancesthecognitivefunctioninpatientswithmoderatelyseverealzheimersdisease‏ ‎‡A Heat-processed ginseng enhances the cognitive function in patients with moderately severe Alzheimer's disease.‏ ‎‡9 1‏
919 ‎‡a highalbuminlevelisapredictoroffavorableresponsetoimmunotherapyinautoimmuneencephalitis‏ ‎‡A High albumin level is a predictor of favorable response to immunotherapy in autoimmune encephalitis‏ ‎‡9 1‏
919 ‎‡a highcellfreednalevelsincerebrospinalfluidpredictleptomeningealseedingofhematologicmalignancy‏ ‎‡A High Cell-Free DNA Levels in Cerebrospinal Fluid Predict Leptomeningeal Seeding of Hematologic Malignancy‏ ‎‡9 1‏
919 ‎‡a highfatdietandvoluntarychronicaerobicexerciserecoveralteredlevelsofagingrelatedtryptophanmetabolitesalongthekynureninepathway‏ ‎‡A High-Fat Diet and Voluntary Chronic Aerobic Exercise Recover Altered Levels of Aging-Related Tryptophan Metabolites along the Kynurenine Pathway‏ ‎‡9 1‏
919 ‎‡a hlaa1101isassociatedwithlevetiracetaminducedpsychiatricadverseevents‏ ‎‡A HLA-A*11:01 is associated with levetiracetam-induced psychiatric adverse events‏ ‎‡9 1‏
919 ‎‡a hlaa3101andlamotrigineinducedseverecutaneousadversedrugreactionsinakoreanpopulation‏ ‎‡A HLA-A*31:01 and lamotrigine-induced severe cutaneous adverse drug reactions in a Korean population‏ ‎‡9 1‏
919 ‎‡a hlab4002anddrb10403areriskfactorsforoxcarbazepineinducedmaculopapulareruption‏ ‎‡A HLA-B*40:02 and DRB1*04:03 are risk factors for oxcarbazepine-induced maculopapular eruption‏ ‎‡9 1‏
919 ‎‡a hlab27associationofautoimmuneencephalitisinducedbypdl1inhibitor‏ ‎‡A HLA-B27 association of autoimmune encephalitis induced by PD-L1 inhibitor‏ ‎‡9 1‏
919 ‎‡a hlasassociatedwithperampanelinducedpsychiatricadverseeffectsinakoreanpopulation‏ ‎‡A HLAs associated with perampanel-induced psychiatric adverse effects in a Korean population‏ ‎‡9 1‏
919 ‎‡a hmgcoareductaseinhibitoratorvastatinpromotessensorimotorrecoverysuppressingacuteinflammatoryreactionafterexperimentalintracerebralhemorrhage‏ ‎‡A HMG-CoA reductase inhibitor, atorvastatin, promotes sensorimotor recovery, suppressing acute inflammatory reaction after experimental intracerebral hemorrhage‏ ‎‡9 1‏
919 ‎‡a humanembryonicstemcellderivedneuralprecursortransplantsattenuateapomorphineinducedrotationalbehaviorinratswithunilateralquinolinicacidlesions‏ ‎‡A Human embryonic stem cell-derived neural precursor transplants attenuate apomorphine-induced rotational behavior in rats with unilateral quinolinic acid lesions‏ ‎‡9 1‏
919 ‎‡a humanleukocyteantigenassociationsinposturaltachycardiasyndrome‏ ‎‡A Human leukocyte antigen associations in postural tachycardia syndrome‏ ‎‡9 1‏
919 ‎‡a humanneuralstemcelltransplantationreducesspontaneousrecurrentseizuresfollowingpilocarpineinducedstatusepilepticusinadultrats‏ ‎‡A Human neural stem cell transplantation reduces spontaneous recurrent seizures following pilocarpine-induced status epilepticus in adult rats‏ ‎‡9 1‏
919 ‎‡a humanneuralstemcellsimprovesensorimotordeficitsintheadultratbrainwithexperimentalfocalischemia‏ ‎‡A Human neural stem cells improve sensorimotor deficits in the adult rat brain with experimental focal ischemia‏ ‎‡9 1‏
919 ‎‡a ictalasystoleandeatingreflexseizureswithtemporallobeepilepsy‏ ‎‡A Ictal asystole and eating reflex seizures with temporal lobe epilepsy.‏ ‎‡9 1‏
919 ‎‡a identificationofcerebralperfusionusingarterialspinlabelinginpatientswithseizuresinacutesettings‏ ‎‡A Identification of cerebral perfusion using arterial spin labeling in patients with seizures in acute settings‏ ‎‡9 1‏
919 ‎‡a identificationofneuronaloutgrowthcellsfromperipheralbloodofstrokepatients‏ ‎‡A Identification of neuronal outgrowth cells from peripheral blood of stroke patients.‏ ‎‡9 1‏
919 ‎‡a impactofaselectivecyclooxygenase2inhibitorcelecoxiboncorticalexcitabilityandelectrophysiologicalpropertiesofthebraininhealthyvolunteersarandomizeddoubleblindplacebocontrolledstudy‏ ‎‡A Impact of a selective cyclooxygenase-2 inhibitor, celecoxib, on cortical excitability and electrophysiological properties of the brain in healthy volunteers: A randomized, double-blind, placebo-controlled study‏ ‎‡9 1‏
919 ‎‡a impactofinterimprogressionduringthesurgerytoradiotherapyintervalanditspredictorsinglioblastomatreatedwithtemozolomidebasedradiochemotherapy‏ ‎‡A Impact of interim progression during the surgery-to-radiotherapy interval and its predictors in glioblastoma treated with temozolomide-based radiochemotherapy.‏ ‎‡9 1‏
919 ‎‡a impactofstrokemechanisminacutebasilarocclusionwithreperfusiontherapy‏ ‎‡A Impact of stroke mechanism in acute basilar occlusion with reperfusion therapy.‏ ‎‡9 1‏
919 ‎‡a improvementofcognitivedeficitinalzheimersdiseasepatientsbylongtermtreatmentwithkoreanredginseng‏ ‎‡A Improvement of cognitive deficit in Alzheimer's disease patients by long term treatment with korean red ginseng‏ ‎‡9 1‏
919 ‎‡a increasedadverseeventsassociatedwithantiepilepticdrugsinantileucinerichgliomainactivatedprotein1encephalitis‏ ‎‡A Increased adverse events associated with antiepileptic drugs in anti-leucine-rich glioma-inactivated protein 1 encephalitis‏ ‎‡9 1‏
919 ‎‡a increasedarterialpulsatilityandprogressionofsinglesubcorticalinfarction‏ ‎‡A Increased arterial pulsatility and progression of single subcortical infarction.‏ ‎‡9 1‏
919 ‎‡a increasedcirculatingendothelialmicroparticlesandcarotidatherosclerosisinobstructivesleepapnea‏ ‎‡A Increased circulating endothelial microparticles and carotid atherosclerosis in obstructive sleep apnea.‏ ‎‡9 1‏
919 ‎‡a increasingprevalenceofantimicrobialresistanceinurinarytractinfectionsofneurologicalpatientsseoulsouthkorea2007‏ ‎‡A Increasing prevalence of antimicrobial resistance in urinary tract infections of neurological patients, Seoul, South Korea, 2007-2016‏ ‎‡9 1‏
919 ‎‡a inductionofburstsuppressionorcomausingintravenousanestheticsinrefractorystatusepilepticus‏ ‎‡A Induction of burst suppression or coma using intravenous anesthetics in refractory status epilepticus‏ ‎‡9 1‏
919 ‎‡a inhibitionoflet7cmicrornaisneuroprotectiveinaratintracerebralhemorrhagemodel‏ ‎‡A Inhibition of Let7c microRNA is neuroprotective in a rat intracerebral hemorrhage model‏ ‎‡9 1‏
919 ‎‡a inhibitionofmir203reducesspontaneousrecurrentseizuresinmice‏ ‎‡A Inhibition of miR-203 Reduces Spontaneous Recurrent Seizures in Mice‏ ‎‡9 1‏
919 ‎‡a intrathecalspecificglutamicaciddecarboxylaseantibodiesatlowtitersinautoimmuneneurologicaldisorders‏ ‎‡A Intrathecal-specific glutamic acid decarboxylase antibodies at low titers in autoimmune neurological disorders.‏ ‎‡9 1‏
919 ‎‡a intravenousadministrationofhumanneuralstemcellsinducesfunctionalrecoveryinhuntingtonsdiseaseratmodel‏ ‎‡A Intravenous administration of human neural stem cells induces functional recovery in Huntington's disease rat model‏ ‎‡9 1‏
919 ‎‡a isolatedandprolongedlossoftimeorientation‏ ‎‡A Isolated and prolonged loss of time orientation‏ ‎‡9 1‏
919 ‎‡a let7micrornainhibitstheproliferationofhumanglioblastomacells‏ ‎‡A Let-7 microRNA inhibits the proliferation of human glioblastoma cells‏ ‎‡9 1‏
919 ‎‡a lgi1expressionandhumanbrainasymmetryinsightsfrompatientswithlgi1antibodyencephalitis‏ ‎‡A LGI1 expression and human brain asymmetry: insights from patients with LGI1-antibody encephalitis‏ ‎‡9 1‏
919 ‎‡a lightinducedamaurosisfugaxduetoseveredistalinternalcarotidarterystenosisinviewofmanagingocularischemicsyndrome‏ ‎‡A Light-induced amaurosis fugax due to severe distal internal carotid artery stenosis: in view of managing ocular ischemic syndrome.‏ ‎‡9 1‏
919 ‎‡a lossofpericytesinradiationnecrosisafterglioblastomatreatments‏ ‎‡A Loss of Pericytes in Radiation Necrosis after Glioblastoma Treatments.‏ ‎‡9 1‏
919 ‎‡a maternalimmuneactivationaltersbrainmicrornaexpressioninmouseoffspring‏ ‎‡A Maternal immune activation alters brain microRNA expression in mouse offspring‏ ‎‡9 1‏
919 ‎‡a mefloquineimprovedprogressivemultifocalleukoencephalopathyinapatientwithimmunoglobulinanephropathy‏ ‎‡A Mefloquine improved progressive multifocal leukoencephalopathy in a patient with immunoglobulin A nephropathy‏ ‎‡9 1‏
919 ‎‡a megadosephenobarbitaltherapyforsuperrefractorystatusepilepticus‏ ‎‡A Mega-dose phenobarbital therapy for super-refractory status epilepticus‏ ‎‡9 1‏
919 ‎‡a memantinereduceshematomaexpansioninexperimentalintracerebralhemorrhageresultinginfunctionalimprovement‏ ‎‡A Memantine reduces hematoma expansion in experimental intracerebral hemorrhage, resulting in functional improvement‏ ‎‡9 1‏
919 ‎‡a memantinereducesstriatalcelldeathwithdecreasingcalpainlevelin3nitropropionicmodelofhuntingtonsdisease‏ ‎‡A Memantine reduces striatal cell death with decreasing calpain level in 3-nitropropionic model of Huntington's disease‏ ‎‡9 1‏
919 ‎‡a micrornasinducedduringischemicpreconditioning‏ ‎‡A MicroRNAs induced during ischemic preconditioning‏ ‎‡9 1‏
919 ‎‡a mir206regulatesbrainderivedneurotrophicfactorinalzheimerdiseasemodel‏ ‎‡A miR-206 regulates brain-derived neurotrophic factor in Alzheimer disease model‏ ‎‡9 1‏
919 ‎‡a modulationofmitochondrialfunctionbystemcellderivedcellularcomponents‏ ‎‡A Modulation of mitochondrial function by stem cell-derived cellular components.‏ ‎‡9 1‏
919 ‎‡a mogantibodyassociatedencephalitisinadultclinicalphenotypesandoutcomes‏ ‎‡A MOG antibody-associated encephalitis in adult: clinical phenotypes and outcomes‏ ‎‡9 1‏
919 ‎‡a molecularalterationsunderlyingepileptogenesisafterprolongedfebrileseizureandmodulationbyerythropoietin‏ ‎‡A Molecular alterations underlying epileptogenesis after prolonged febrile seizure and modulation by erythropoietin.‏ ‎‡9 1‏
919 ‎‡a mrimaginganalysisofnonmeasurableenhancinglesionsnewlyappearingafterconcomitantchemoradiotherapyinglioblastomapatientsforprognosisprediction‏ ‎‡A MR Imaging Analysis of Non-Measurable Enhancing Lesions Newly Appearing after Concomitant Chemoradiotherapy in Glioblastoma Patients for Prognosis Prediction‏ ‎‡9 1‏
919 ‎‡a multidrugresistanceprotein1reducestheaggregationofmutanthuntingtininneuronalcellsderivedfromthehuntingtonsdiseaser62model‏ ‎‡A Multidrug resistance protein 1 reduces the aggregation of mutant huntingtin in neuronal cells derived from the Huntington's disease R6/2 model‏ ‎‡9 1‏
919 ‎‡a multipotentpdgfrβexpressingcellsinthecirculationofstrokepatients‏ ‎‡A Multipotent PDGFRβ-expressing cells in the circulation of stroke patients‏ ‎‡9 1‏
919 ‎‡a neurobehcetsdiseasemimickingmultiplebraintumorsdiffusionweightedmrstudyandliteraturereview‏ ‎‡A Neuro-Behcet's disease mimicking multiple brain tumors: diffusion-weighted MR study and literature review‏ ‎‡9 1‏
919 ‎‡a neuropathologicandclinicalfeaturesofhumanmedialtemporallobeepilepsy‏ ‎‡A Neuropathologic and clinical features of human medial temporal lobe epilepsy.‏ ‎‡9 1‏
919 ‎‡a neuroprotectiveeffectofacellfreeextractderivedfromhumanadiposestemcellsinexperimentalstrokemodels‏ ‎‡A Neuroprotective effect of a cell-free extract derived from human adipose stem cells in experimental stroke models‏ ‎‡9 1‏
919 ‎‡a neuroprotectiveeffectofneuralstemcellconditionedmediaininvitromodelofhuntingtonsdisease‏ ‎‡A Neuroprotective effect of neural stem cell-conditioned media in in vitro model of Huntington's disease‏ ‎‡9 1‏
919 ‎‡a neurotoxicsyndromedevelopedaftertakingsertralineandrisperidone‏ ‎‡A Neurotoxic syndrome developed after taking sertraline and risperidone‏ ‎‡9 1‏
919 ‎‡a neurovascularcellsheettransplantationinacaninemodelofintracranialhemorrhage‏ ‎‡A Neurovascular Cell Sheet Transplantation in a Canine Model of Intracranial Hemorrhage‏ ‎‡9 1‏
919 ‎‡a newconceptofneuralstemcelltransplantationantiinflammatoryrole‏ ‎‡A New Concept of Neural Stem Cell Transplantation: Anti-inflammatory Role.‏ ‎‡9 1‏
919 ‎‡a newfeasibletreatmentforrefractoryautoimmuneencephalitislowdoseinterleukin2‏ ‎‡A New feasible treatment for refractory autoimmune encephalitis: Low-dose interleukin-2.‏ ‎‡9 1‏
919 ‎‡a nonstiffantiamphiphysinsyndromeclinicalmanifestationsandoutcomeafterimmunotherapy‏ ‎‡A Non-stiff anti-amphiphysin syndrome: clinical manifestations and outcome after immunotherapy‏ ‎‡9 1‏
919 ‎‡a noninvasivemethodofimmortalizedneuralstemlikecelltransplantationinanexperimentalmodelofhuntingtonsdisease‏ ‎‡A Noninvasive method of immortalized neural stem-like cell transplantation in an experimental model of Huntington's disease‏ ‎‡9 1‏
919 ‎‡a novelmutationintheatl1withautosomaldominanthereditaryspasticparaplegiapresentedasdysautonomia‏ ‎‡A Novel mutation in the ATL1 with autosomal dominant hereditary spastic paraplegia presented as dysautonomia.‏ ‎‡9 1‏
919 ‎‡a novelrecursivepartitioninganalysisclassificationfornewlydiagnosedglioblastomaamultiinstitutionalstudyhighlightingthemgmtpromotermethylationandidh1genemutationstatus‏ ‎‡A Novel recursive partitioning analysis classification for newly diagnosed glioblastoma: A multi-institutional study highlighting the MGMT promoter methylation and IDH1 gene mutation status‏ ‎‡9 1‏
919 ‎‡a nremsleepeegoscillationsinidiopathicremsleepbehaviordisorderastudyofsleepspindlesandslowoscillations‏ ‎‡A NREM Sleep EEG Oscillations in Idiopathic REM Sleep Behavior Disorder: A study of sleep spindles and slow oscillations‏ ‎‡9 1‏
919 ‎‡a nuclearlocalizationofhuntingtinduringspermatogenesis‏ ‎‡A Nuclear localization of huntingtin during spermatogenesis‏ ‎‡9 1‏
919 ‎‡a orthostaticintolerancesymptomsareassociatedwithdepressionanddiminishedqualityoflifeinpatientswithposturaltachycardiasyndrome‏ ‎‡A Orthostatic intolerance symptoms are associated with depression and diminished quality of life in patients with postural tachycardia syndrome‏ ‎‡9 1‏
919 ‎‡a panaxginsengenhancescognitiveperformanceinalzheimerdisease‏ ‎‡A Panax ginseng enhances cognitive performance in Alzheimer disease.‏ ‎‡9 1‏
919 ‎‡a paradoxicalchoroidplexitisduringtreatmentfortuberculousmeningoencephalitis‏ ‎‡A Paradoxical Choroid Plexitis during Treatment for Tuberculous Meningoencephalitis‏ ‎‡9 1‏
919 ‎‡a periodicityofcerebralflowvelocityduringsleepanditsassociationwithwhitematterhyperintensityvolume‏ ‎‡A Periodicity of cerebral flow velocity during sleep and its association with white-matter hyperintensity volume‏ ‎‡9 1‏
919 ‎‡a peroxisomeproliferatoractivatedreceptorgammaagonistrosiglitazonepromotesangiogenesisafterfocalcerebralischemia‏ ‎‡A Peroxisome proliferator-activated receptor-gamma-agonist, rosiglitazone, promotes angiogenesis after focal cerebral ischemia‏ ‎‡9 1‏
919 ‎‡a pharmacologicalinductionofheatshockproteinexertsneuroprotectiveeffectsinexperimentalintracerebralhemorrhage‏ ‎‡A Pharmacological induction of heat shock protein exerts neuroprotective effects in experimental intracerebral hemorrhage‏ ‎‡9 1‏
919 ‎‡a pharmacologicalinductionofischemictolerancebyglutamatetransporter1‏ ‎‡A Pharmacological Induction of Ischemic Tolerance by Glutamate Transporter-1‏ ‎‡9 1‏
919 ‎‡a pharmacologicalinductionofischemictolerancebyglutamatetransporter1eaat2upregulation‏ ‎‡A Pharmacological Induction of Ischemic Tolerance by Glutamate Transporter-1 (EAAT2) Upregulation‏ ‎‡9 1‏
919 ‎‡a pharmacologicaltreatmentofepilepsyinelderlypatients‏ ‎‡A Pharmacological Treatment of Epilepsy in Elderly Patients‏ ‎‡9 1‏
919 ‎‡a pneumoniainhospitalizedneurologicpatientstrendsinpathogendistributionandantibioticsusceptibility‏ ‎‡A Pneumonia in hospitalized neurologic patients: trends in pathogen distribution and antibiotic susceptibility‏ ‎‡9 1‏
919 ‎‡a populationpharmacokineticsanddoseresponserelationshipoflevetiracetaminadultpatientswithepilepsy‏ ‎‡A Population pharmacokinetics and dose-response relationship of levetiracetam in adult patients with epilepsy‏ ‎‡9 1‏
919 ‎‡a possibleepigeneticregulatoryeffectofdysregulatedcircularrnasinalzheimersdiseasemodel‏ ‎‡A Possible epigenetic regulatory effect of dysregulated circular RNAs in Alzheimer's disease model‏ ‎‡9 1‏
919 ‎‡a possibleepigeneticregulatoryeffectofdysregulatedcircularrnasinepilepsy‏ ‎‡A Possible epigenetic regulatory effect of dysregulated circular RNAs in epilepsy‏ ‎‡9 1‏
919 ‎‡a predictorsofsurvivalforpatientswithcanceraftercryptogenicstroke‏ ‎‡A Predictors of survival for patients with cancer after cryptogenic stroke‏ ‎‡9 1‏
919 ‎‡a prevalenceofantineuronalantibodiesinpatientswithencephalopathyofunknownetiologydatafromanationwideregistryinkorea‏ ‎‡A Prevalence of antineuronal antibodies in patients with encephalopathy of unknown etiology: Data from a nationwide registry in Korea.‏ ‎‡9 1‏
919 ‎‡a profilesofmultidrugresistanceprotein1intheperipheralbloodmononuclearcellsofpatientswithrefractoryepilepsy‏ ‎‡A Profiles of multidrug resistance protein-1 in the peripheral blood mononuclear cells of patients with refractory epilepsy‏ ‎‡9 1‏
919 ‎‡a prognosisofspontaneouscervicalarterydissectionandtranscranialdopplerfindingsassociatedwithclinicaloutcomes‏ ‎‡A Prognosis of spontaneous cervical artery dissection and transcranial Doppler findings associated with clinical outcomes‏ ‎‡9 1‏
919 ‎‡a usefulnessofsalivaforperampaneltherapeuticdrugmonitoring‏ ‎‡A Usefulness of saliva for perampanel therapeutic drug monitoring‏ ‎‡9 1‏
919 ‎‡a prognosispredictionofnonenhancingt2highsignalintensitylesionsinglioblastomapatientsafterstandardtreatmentapplicationofdynamiccontrastenhancedmrimaging‏ ‎‡A Prognosis prediction of non-enhancing T2 high signal intensity lesions in glioblastoma patients after standard treatment: application of dynamic contrast-enhanced MR imaging.‏ ‎‡9 1‏
919 ‎‡a prognosticpredictionsforpatientswithglioblastomaafterstandardtreatmentapplicationofcontrastleakageinformationfromdscmriwithinnonenhancingflairhighsignalintensitylesions‏ ‎‡A Prognostic Predictions for Patients with Glioblastoma after Standard Treatment: Application of Contrast Leakage Information from DSC-MRI within Nonenhancing FLAIR High-Signal-Intensity Lesions‏ ‎‡9 1‏
919 ‎‡a prognosticvalueofinitialstandardeegandmriinpatientswithherpessimplexencephalitis‏ ‎‡A Prognostic Value of Initial Standard EEG and MRI in Patients with Herpes Simplex Encephalitis‏ ‎‡9 1‏
919 ‎‡a progressionofcerebralwhitematterhyperintensitiesandtheassociatedsonographicindex‏ ‎‡A Progression of Cerebral White Matter Hyperintensities and the Associated Sonographic Index‏ ‎‡9 1‏
919 ‎‡a prolongedreleasemelatonininpatientswithidiopathicremsleepbehaviordisorder‏ ‎‡A Prolonged-release melatonin in patients with idiopathic REM sleep behavior disorder‏ ‎‡9 1‏
919 ‎‡a proteasomalinhibitioninintracerebralhemorrhageneuroprotectiveandantiinflammatoryeffectsofbortezomib‏ ‎‡A Proteasomal inhibition in intracerebral hemorrhage: neuroprotective and anti-inflammatory effects of bortezomib‏ ‎‡9 1‏
919 ‎‡a psychiatricsymptomsdelaythediagnosisofantilgi1encephalitis‏ ‎‡A Psychiatric symptoms delay the diagnosis of anti-LGI1 encephalitis.‏ ‎‡9 1‏
919 ‎‡a quantificationofhumanneuralstemcellengraftmentsinratbrainsusingerv3realtimepcr‏ ‎‡A Quantification of human neural stem cell engraftments in rat brains using ERV-3 real-time PCR.‏ ‎‡9 1‏
919 ‎‡a radiogenomicscorrelationbetweenmrimagingfeaturesandmajorgeneticprofilesinglioblastoma‏ ‎‡A Radiogenomics correlation between MR imaging features and major genetic profiles in glioblastoma.‏ ‎‡9 1‏
919 ‎‡a rapiddiagnosisofbacterialmeningitisbynanopore16sampliconsequencingapilotstudy‏ ‎‡A Rapid diagnosis of bacterial meningitis by nanopore 16S amplicon sequencing: A pilot study‏ ‎‡9 1‏
919 ‎‡a reducedp300amplitudeduringavisuospatialattentiontaskinidiopathicrapideyemovementsleepbehaviordisorder‏ ‎‡A Reduced P300 amplitude during a visuospatial attention task in idiopathic rapid eye movement sleep behavior disorder.‏ ‎‡9 1‏
919 ‎‡a reemergenceofjapaneseencephalitisinsouthkorea2010‏ ‎‡A Reemergence of Japanese Encephalitis in South Korea, 2010–2015‏ ‎‡9 1‏
919 ‎‡a refininggeneralprinciplesofantiepilepticdrugtreatmentsforepilepsy‏ ‎‡A Refining General Principles of Antiepileptic Drug Treatments for Epilepsy‏ ‎‡9 1‏
919 ‎‡a regionspecificplasticityintheepilepticratbrainahippocampalandextrahippocampalanalysis‏ ‎‡A Region-specific plasticity in the epileptic rat brain: a hippocampal and extrahippocampal analysis‏ ‎‡9 1‏
919 ‎‡a replytogradingtheseverityofautoimmuneencephalitisadvancesandpitfalls‏ ‎‡A Reply to "Grading the severity of autoimmune encephalitis: Advances and pitfalls" ‏ ‎‡9 1‏
919 ‎‡a replytogradingtheseverityofautoimmuneencephalitiswhentoevaluate‏ ‎‡A Reply to "Grading the Severity of Autoimmune Encephalitis: When to Evaluate?" ‏ ‎‡9 1‏
919 ‎‡a rhythmicalphoticstimulationat Alpha frequenciesproducesantidepressantlikeeffectsinamousemodelofdepression‏ ‎‡A Rhythmical Photic Stimulation at Alpha Frequencies Produces Antidepressant-Like Effects in a Mouse Model of Depression‏ ‎‡9 1‏
919 ‎‡a riskofmacrovascularcomplicationsintype2diabetesmellitusendothelialmicroparticleprofiles‏ ‎‡A Risk of macrovascular complications in type 2 diabetes mellitus: endothelial microparticle profiles‏ ‎‡9 1‏
919 ‎‡a rituximabtreatmentforautoimmunelimbicencephalitisinaninstitutionalcohort‏ ‎‡A Rituximab treatment for autoimmune limbic encephalitis in an institutional cohort‏ ‎‡9 1‏
919 ‎‡a rituximabtreatmentforidiopathichypertrophicpachymeningitis‏ ‎‡A Rituximab Treatment for Idiopathic Hypertrophic Pachymeningitis‏ ‎‡9 1‏
919 ‎‡a roleofcorticaldysplasiainepileptogenesisfollowingprolongedfebrileseizure‏ ‎‡A Role of cortical dysplasia in epileptogenesis following prolonged febrile seizure‏ ‎‡9 1‏
919 ‎‡a safetyoftianeptineuseinpatientswithepilepsy‏ ‎‡A Safety of tianeptine use in patients with epilepsy‏ ‎‡9 1‏
919 ‎‡a screeningofthea11084gpolymorphismandscanningofamitochondrialgenomesnpinkoreanmigraineurs‏ ‎‡A Screening of the A11084G Polymorphism and Scanning of a Mitochondrial Genome SNP in Korean Migraineurs‏ ‎‡9 1‏
919 ‎‡a valproicacidmediatedneuroprotectioninintracerebralhemorrhageviahistonedeacetylaseinhibitionandtranscriptionalactivation‏ ‎‡A Valproic acid-mediated neuroprotection in intracerebral hemorrhage via histone deacetylase inhibition and transcriptional activation.‏ ‎‡9 1‏
919 ‎‡a seronegativeautoimmuneencephalitisclinicalcharacteristicsandfactorsassociatedwithoutcomes‏ ‎‡A Seronegative autoimmune encephalitis: clinical characteristics and factors associated with outcomes‏ ‎‡9 1‏
919 ‎‡a sitespecificrelationshipbetweenintracranialaneurysmandaorticaneurysm‏ ‎‡A Site-Specific Relationship Between Intracranial Aneurysm and Aortic Aneurysm‏ ‎‡9 1‏
919 ‎‡a slowedprogressioninmodelsofhuntingtondiseasebyadiposestemcelltransplantation‏ ‎‡A Slowed progression in models of Huntington disease by adipose stem cell transplantation‏ ‎‡9 1‏
919 ‎‡a solublemediatorsfromhumanneuralstemcellsplayacriticalroleinsuppressionoftcellactivationandproliferation‏ ‎‡A Soluble mediators from human neural stem cells play a critical role in suppression of T-cell activation and proliferation.‏ ‎‡9 1‏
919 ‎‡a sonographicfindingsassociatedwithstenosisprogressionandvascularcomplicationsinmoyamoyadisease‏ ‎‡A Sonographic findings associated with stenosis progression and vascular complications in moyamoya disease.‏ ‎‡9 1‏
919 ‎‡a stemcellbasedcelltherapyforhuntingtondiseaseareview‏ ‎‡A Stem cell-based cell therapy for Huntington disease: a review‏ ‎‡9 1‏
919 ‎‡a stemcellstransplantationandhuntingtonsdisease‏ ‎‡A Stem Cells Transplantation and Huntington's Disease‏ ‎‡9 1‏
919 ‎‡a strokemimickingencephalopathyasaninitialmanifestationofdiffuselargebcelllymphoma‏ ‎‡A Stroke mimicking encephalopathy as an initial manifestation of diffuse large B-cell lymphoma‏ ‎‡9 1‏
919 ‎‡a successfultreatmentofrefractorydyskinesiasecondarytoantinmethyl500aspartatereceptorencephalitiswithelectroconvulsivetherapy‏ ‎‡A Successful Treatment of Refractory Dyskinesia Secondary to Anti-N-Methyl-D-Aspartate Receptor Encephalitis With Electroconvulsive Therapy‏ ‎‡9 1‏
919 ‎‡a sunginsengprotectsendothelialprogenitorcellsfromsenescenceassociatedapoptosis‏ ‎‡A Sun ginseng protects endothelial progenitor cells from senescence associated apoptosis‏ ‎‡9 1‏
919 ‎‡a survivalgainwithreoprtforrecurredhighgradegliomasdependsuponriskgroups‏ ‎‡A Survival gain with re-Op/RT for recurred high-grade gliomas depends upon risk groups‏ ‎‡9 1‏
919 ‎‡a switchingbetweenphenytoingenericsinpatientswithepilepsymayleadtoincreasedriskofbreakthroughseizurechartanalysisandpracticerecommendations‏ ‎‡A Switching between phenytoin generics in patients with epilepsy may lead to increased risk of breakthrough seizure: chart analysis and practice recommendations‏ ‎‡9 1‏
919 ‎‡a systemictransplantationofhumanadiposestemcellsattenuatedcerebralinflammationanddegenerationinahemorrhagicstrokemodel‏ ‎‡A Systemic transplantation of human adipose stem cells attenuated cerebral inflammation and degeneration in a hemorrhagic stroke model.‏ ‎‡9 1‏
919 ‎‡a 100ablinhibitornilotinibasapotentialtherapeuticagentforchroniccerebellarataxia‏ ‎‡A The c-Abl inhibitor, nilotinib, as a potential therapeutic agent for chronic cerebellar ataxia‏ ‎‡9 1‏
919 ‎‡a complexityofdiagnosingposturalorthostatictachycardiasyndromeinfluenceofthediurnalvariability‏ ‎‡A The complexity of diagnosing postural orthostatic tachycardia syndrome: influence of the diurnal variability.‏ ‎‡9 1‏
919 ‎‡a effectofdimlightatnightoncerebralhemodynamicoscillationsduringsleepanearinfraredspectroscopystudy‏ ‎‡A The effect of dim light at night on cerebral hemodynamic oscillations during sleep: A near-infrared spectroscopy study‏ ‎‡9 1‏
919 ‎‡a effectofparoxetineonthereductionofmigrainefrequencyisindependentofitsanxiolyticeffect‏ ‎‡A The Effect of Paroxetine on the Reduction of Migraine Frequency is Independent of Its Anxiolytic Effect‏ ‎‡9 1‏
919 ‎‡a efficacyofcombinedestrogenandbuspironetreatmentinolivopontocerebellaratrophy‏ ‎‡A The efficacy of combined estrogen and buspirone treatment in olivopontocerebellar atrophy‏ ‎‡9 1‏
919 ‎‡a hlaa2402cw0102haplotypeisassociatedwithlamotrigineinducedmaculopapulareruptioninthekoreanpopulation‏ ‎‡A The HLA-A*2402/Cw*0102 haplotype is associated with lamotrigine-induced maculopapular eruption in the Korean population‏ ‎‡9 1‏
919 ‎‡a longtermefficacyandsafetyoflevetiracetaminatertiaryepilepsycentre‏ ‎‡A The long-term efficacy and safety of levetiracetam in a tertiary epilepsy centre‏ ‎‡9 1‏
919 ‎‡a 3yearretentionratesoflevetiracetamtopiramateandoxcarbazepinearetrospectivehospitalbasedstudy‏ ‎‡A Three-Year Retention Rates of Levetiracetam, Topiramate, and Oxcarbazepine: A Retrospective Hospital-Based Study‏ ‎‡9 1‏
919 ‎‡a tocilizumabinautoimmuneencephalitisrefractorytorituximabaninstitutionalcohortstudy‏ ‎‡A Tocilizumab in Autoimmune Encephalitis Refractory to Rituximab: An Institutional Cohort Study.‏ ‎‡9 1‏
919 ‎‡a tocilizumabtreatmentfornewonsetrefractorystatusepilepticus‏ ‎‡A Tocilizumab treatment for new-onset refractory status epilepticus‏ ‎‡9 1‏
919 ‎‡a tolerabilityoflacosamiderapiddosetitrationarandomizedmulticenterprospectiveopenlabelstudy‏ ‎‡A Tolerability of lacosamide rapid dose titration: A randomized, multicenter, prospective, open-label study‏ ‎‡9 1‏
919 ‎‡a toleratednitritetherapyinexperimentalintracerebralhemorrhagerationaleofnitritetherapyinabroadrangeofhyperacutestrokes‏ ‎‡A Tolerated nitrite therapy in experimental intracerebral hemorrhage: Rationale of nitrite therapy in a broad range of hyperacute strokes.‏ ‎‡9 1‏
919 ‎‡a vgkccomplexlgi1antibodyencephalitisclinicalmanifestationsandresponsetoimmunotherapy‏ ‎‡A VGKC-complex/LGI1-antibody encephalitis: clinical manifestations and response to immunotherapy.‏ ‎‡9 1‏
919 ‎‡a treatmentstrategiesforautoimmuneencephalitis‏ ‎‡A Treatment strategies for autoimmune encephalitis‏ ‎‡9 1‏
919 ‎‡a topiramateincreasestheriskofvalproicacidinducedencephalopathy‏ ‎‡A Topiramate increases the risk of valproic acid-induced encephalopathy‏ ‎‡9 1‏
919 ‎‡a transplantationofhumanneuralstemcellsprotectagainstischemiainapreventivemodeviahypoxiainduciblefactor1 Alpha stabilizationinthehostbrain‏ ‎‡A Transplantation of human neural stem cells protect against ischemia in a preventive mode via hypoxia-inducible factor-1 Alpha stabilization in the host brain‏ ‎‡9 1‏
919 ‎‡a transplantationofpatientderivedadiposestemcellsinyac128huntingtonsdiseasetransgenicmice‏ ‎‡A Transplantation of patient-derived adipose stem cells in YAC128 Huntington's disease transgenic mice‏ ‎‡9 1‏
919 ‎‡a uniquebehavioralcharacteristicsandmicrornasignaturesinadrugresistantepilepsymodel‏ ‎‡A Unique behavioral characteristics and microRNA signatures in a drug resistant epilepsy model‏ ‎‡9 1‏
919 ‎‡a whitematterhyperintensitiesandcognitivedysfunctioninalzheimerdisease‏ ‎‡A White matter hyperintensities and cognitive dysfunction in Alzheimer disease‏ ‎‡9 1‏
919 ‎‡a underexpressionofhoxa11isassociatedwithtreatmentresistanceandpoorprognosisinglioblastoma‏ ‎‡A Underexpression of HOXA11 Is Associated with Treatment Resistance and Poor Prognosis in Glioblastoma‏ ‎‡9 1‏
919 ‎‡a unfavorablesurgicaloutcomesinpartialepilepsywithsecondarybilateralsynchronyintracranialelectroencephalographystudy‏ ‎‡A Unfavorable surgical outcomes in partial epilepsy with secondary bilateral synchrony: Intracranial electroencephalography study.‏ ‎‡9 1‏
943 ‎‡a 201x‏ ‎‡A 2016‏ ‎‡9 3‏
996 ‎‡2 ISNI|0000000464778786
996 ‎‡2 NII|DA02162455
996 ‎‡2 ISNI|0000000505786994
996 ‎‡2 ISNI|0000000468278551
996 ‎‡2 ISNI|0000000464633018
996 ‎‡2 BLBNB|000234462
996 ‎‡2 ISNI|0000000492993387
996 ‎‡2 ISNI|0000000475141772
996 ‎‡2 LC|no2021105386
996 ‎‡2 ISNI|0000000464867594
996 ‎‡2 ISNI|0000000491604079
996 ‎‡2 ISNI|000000002340202X
996 ‎‡2 RERO|A023562764
996 ‎‡2 ISNI|0000000049776265
996 ‎‡2 ISNI|0000000493207296
996 ‎‡2 ISNI|0000000477338413
996 ‎‡2 NUKAT|n 2013156442
996 ‎‡2 ISNI|0000000464850944
996 ‎‡2 SUDOC|279627319
996 ‎‡2 ISNI|0000000493976503
996 ‎‡2 ISNI|0000000475916427
996 ‎‡2 ISNI|000000047518393X
996 ‎‡2 LC|no2022053665
996 ‎‡2 ISNI|000000047769969X
996 ‎‡2 LC|n 2021037103
996 ‎‡2 ISNI|0000000494005768
996 ‎‡2 ISNI|0000000050062032
996 ‎‡2 DNB|1139716344
996 ‎‡2 LC|n 82074716
996 ‎‡2 ISNI|0000000480110807
996 ‎‡2 RERO|A024048215
996 ‎‡2 NLA|000035297485
996 ‎‡2 ISNI|0000000475208957
996 ‎‡2 DNB|1245460897
996 ‎‡2 ISNI|0000000465146780
996 ‎‡2 ISNI|0000000051897541
996 ‎‡2 ISNI|0000000473711209
996 ‎‡2 ISNI|000000051687691X
996 ‎‡2 ISNI|0000000464412848
996 ‎‡2 ISNI|0000000483498878
996 ‎‡2 DNB|119198061
996 ‎‡2 ISNI|0000000467023098
996 ‎‡2 ISNI|0000000477496075
996 ‎‡2 ISNI|000000046834554X
996 ‎‡2 ISNI|0000000464905132
996 ‎‡2 ISNI|0000000460689938
996 ‎‡2 ISNI|000000047395071X
996 ‎‡2 ISNI|0000000493981919
996 ‎‡2 ISNI|0000000467722534
996 ‎‡2 ISNI|0000000505381444
996 ‎‡2 ISNI|0000000503713396
996 ‎‡2 ISNI|0000000513667282
996 ‎‡2 BIBSYS|99051271
996 ‎‡2 ISNI|0000000075300551
996 ‎‡2 ISNI|0000000477601402
996 ‎‡2 ISNI|0000000505924306
996 ‎‡2 ISNI|0000000477257349
996 ‎‡2 ISNI|0000000395841162
996 ‎‡2 ISNI|0000000492353873
996 ‎‡2 ISNI|000000050521913X
996 ‎‡2 ISNI|0000000516715008
996 ‎‡2 ISNI|0000000464412530
996 ‎‡2 BNF|16572170
996 ‎‡2 NII|DA06781765
996 ‎‡2 ISNI|0000000512322012
996 ‎‡2 NSK|000346984
996 ‎‡2 ISNI|000000048026008X
996 ‎‡2 ISNI|0000000505799680
996 ‎‡2 BIBSYS|1006852
996 ‎‡2 ISNI|0000000474016021
996 ‎‡2 LC|n 2001119603
996 ‎‡2 LC|n 87820889
996 ‎‡2 ISNI|0000000465018914
996 ‎‡2 ISNI|0000000463341144
996 ‎‡2 DNB|1038080762
996 ‎‡2 ISNI|0000000491653022
996 ‎‡2 ISNI|0000000476792024
996 ‎‡2 ISNI|0000000475980218
996 ‎‡2 LC|nr2007005250
996 ‎‡2 ISNI|0000000479235944
996 ‎‡2 ISNI|0000000513667194
996 ‎‡2 ISNI|0000000508115408
996 ‎‡2 ISNI|0000000483872030
996 ‎‡2 ISNI|0000000464779244
996 ‎‡2 ISNI|0000000491804310
996 ‎‡2 ISNI|0000000078739551
996 ‎‡2 BIBSYS|4067111
996 ‎‡2 NUKAT|n 98001111
996 ‎‡2 ISNI|0000000475527907
996 ‎‡2 LC|n 91044060
996 ‎‡2 SUDOC|187445818
996 ‎‡2 ISNI|0000000491820564
996 ‎‡2 ISNI|000000050512478X
996 ‎‡2 ISNI|0000000479180402
996 ‎‡2 ISNI|000000048020239X
996 ‎‡2 ISNI|0000000024229644
996 ‎‡2 ISNI|0000000082146492
996 ‎‡2 ISNI|0000000466956750
996 ‎‡2 LC|nr 98023423
996 ‎‡2 ISNI|0000000052725012
996 ‎‡2 LC|n 78059809
996 ‎‡2 ISNI|0000000468548435
996 ‎‡2 LC|n 2019024863
996 ‎‡2 NTA|110256859
996 ‎‡2 ISNI|0000000483893763
996 ‎‡2 ISNI|0000000459350064
996 ‎‡2 DNB|1166192091
996 ‎‡2 LC|n 84133932
996 ‎‡2 ISNI|0000000465033989
996 ‎‡2 ISNI|0000000045677825
996 ‎‡2 ISNI|000000047248880X
996 ‎‡2 ISNI|0000000463656226
996 ‎‡2 ISNI|000000047907428X
996 ‎‡2 ISNI|0000000050584105
996 ‎‡2 ISNI|0000000480086747
996 ‎‡2 ISNI|0000000493963702
996 ‎‡2 LC|nr 95038645
996 ‎‡2 ISNI|000000047248901X
996 ‎‡2 ISNI|0000000436939554
996 ‎‡2 ISNI|0000000505299504
996 ‎‡2 ISNI|0000000492527941
996 ‎‡2 NLB|18593178
996 ‎‡2 NII|DA12031089
996 ‎‡2 ISNI|0000000491823562
996 ‎‡2 PLWABN|9810591515705606
996 ‎‡2 LC|no2010180093
996 ‎‡2 ISNI|0000000373904003
996 ‎‡2 ISNI|0000000513635491
996 ‎‡2 ISNI|0000000473401921
996 ‎‡2 ISNI|0000000512737867
996 ‎‡2 ISNI|0000000476702383
996 ‎‡2 NSK|000465796
996 ‎‡2 ISNI|0000000483575802
996 ‎‡2 ISNI|0000000476729033
996 ‎‡2 SUDOC|258327006
996 ‎‡2 ISNI|000000047783525X
996 ‎‡2 ISNI|0000000050111391
996 ‎‡2 ISNI|0000000463240714
996 ‎‡2 ISNI|0000000512297646
996 ‎‡2 ISNI|0000000473855843
996 ‎‡2 J9U|987007438426405171
996 ‎‡2 ISNI|0000000480177577
996 ‎‡2 ISNI|0000000023438057
996 ‎‡2 ISNI|0000000463402082
996 ‎‡2 NTA|303073527
996 ‎‡2 ISNI|0000000491964883
996 ‎‡2 LC|no2012045526
996 ‎‡2 ISNI|0000000467784751
996 ‎‡2 LC|nr 96025138
996 ‎‡2 ISNI|0000000464783251
996 ‎‡2 ISNI|0000000505929991
996 ‎‡2 LC|n 50039574
996 ‎‡2 ISNI|0000000464664762
996 ‎‡2 ISNI|0000000513635571
996 ‎‡2 ISNI|0000000468468398
996 ‎‡2 ISNI|0000000492354139
996 ‎‡2 ISNI|0000000124900810
996 ‎‡2 BIBSYS|90330184
996 ‎‡2 LC|nr 93024343
996 ‎‡2 ISNI|000000049223839X
996 ‎‡2 CAOONL|ncf11448852
996 ‎‡2 ISNI|0000000468465680
996 ‎‡2 ISNI|0000000493979309
996 ‎‡2 DNB|1169097537
996 ‎‡2 LC|n 82254067
996 ‎‡2 ISNI|0000000493979923
996 ‎‡2 NDL|01146168
996 ‎‡2 ISNI|0000000407756425
996 ‎‡2 ISNI|0000000468465314
996 ‎‡2 LC|n 98081758
996 ‎‡2 DNB|1159025819
996 ‎‡2 ISNI|0000000509029026
996 ‎‡2 DNB|1074172736
996 ‎‡2 ISNI|0000000459350048
996 ‎‡2 ISNI|0000000479238416
996 ‎‡2 ISNI|0000000493069727
996 ‎‡2 ISNI|0000000493961336
996 ‎‡2 ISNI|0000000115857136
996 ‎‡2 ISNI|0000000493901915
996 ‎‡2 LC|n 99804100
996 ‎‡2 ISNI|0000000472489052
996 ‎‡2 DNB|1051410568
996 ‎‡2 LC|n 2024021886
996 ‎‡2 ISNI|0000000475034707
996 ‎‡2 ISNI|0000000505498343
996 ‎‡2 ISNI|0000000461118803
996 ‎‡2 ISNI|0000000460129877
996 ‎‡2 ISNI|0000000464412872
996 ‎‡2 RERO|A006202569
996 ‎‡2 ISNI|0000000465139302
996 ‎‡2 ISNI|000000046476240X
996 ‎‡2 LC|nr 98027624
996 ‎‡2 LC|n 2006184129
996 ‎‡2 BNF|13626499
996 ‎‡2 NTA|344683915
996 ‎‡2 ISNI|0000000505195262
996 ‎‡2 ISNI|0000000503599933
996 ‎‡2 ISNI|000000050354596X
996 ‎‡2 ISNI|0000000464369202
996 ‎‡2 ISNI|0000000480871139
996 ‎‡2 ISNI|000000046479011X
996 ‎‡2 LC|n 89671798
996 ‎‡2 ISNI|0000000483582615
996 ‎‡2 ISNI|000000050531900X
996 ‎‡2 ISNI|0000000366058785
996 ‎‡2 ISNI|0000000468300149
996 ‎‡2 ISNI|0000000431061199
996 ‎‡2 ISNI|0000000463276346
996 ‎‡2 ISNI|0000000483560053
996 ‎‡2 ISNI|0000000467655562
996 ‎‡2 LC|no2021105274
996 ‎‡2 ISNI|000000046340212X
996 ‎‡2 LC|n 2015031085
996 ‎‡2 ISNI|0000000464756413
996 ‎‡2 ISNI|0000000512528950
996 ‎‡2 ISNI|0000000067740346
996 ‎‡2 ISNI|0000000480202525
996 ‎‡2 ISNI|0000000465098803
996 ‎‡2 ISNI|0000000039042495
996 ‎‡2 ISNI|0000000474007969
996 ‎‡2 SUDOC|145227103
996 ‎‡2 CAOONL|ncf10254555
996 ‎‡2 ISNI|0000000475965472
996 ‎‡2 BIBSYS|90519814
996 ‎‡2 J9U|987007286180305171
996 ‎‡2 NII|DA14216777
996 ‎‡2 ISNI|0000000464929636
996 ‎‡2 ISNI|000000046441259X
996 ‎‡2 DNB|130272558
996 ‎‡2 BNF|15746978
996 ‎‡2 SUDOC|252897102
996 ‎‡2 LIH|LNB:C_b_1K;=BH
996 ‎‡2 ISNI|000000049398209X
996 ‎‡2 DNB|1089445970
996 ‎‡2 ISNI|0000000493981353
996 ‎‡2 DNB|1154617645
996 ‎‡2 LC|n 99265616
996 ‎‡2 ISNI|0000000464845336
996 ‎‡2 ISNI|0000000505945035
996 ‎‡2 ISNI|0000000493980465
996 ‎‡2 ISNI|000000048349771X
996 ‎‡2 BIBSYS|90234865
996 ‎‡2 ISNI|0000000477319335
996 ‎‡2 LC|no2016123233
996 ‎‡2 ISNI|0000000491935046
996 ‎‡2 ISNI|0000000468166197
996 ‎‡2 RERO|A003507437
996 ‎‡2 ISNI|0000000473921732
996 ‎‡2 ISNI|0000000493245604
996 ‎‡2 LC|no 00084370
997 ‎‡a 0 0 lived 0 0‏ ‎‡9 1‏