VIAF

Virtual International Authority File

Search

Leader 00000nz a2200037n 45 0
001 WKP|Q87811272 (VIAF cluster) (Authority/Source Record)
003 WKP
005 20241221010858.0
008 241221nneanz||abbn n and d
035 ‎‡a (WKP)Q87811272‏
024 ‎‡a 0000-0002-5706-4377‏ ‎‡2 orcid‏
035 ‎‡a (OCoLC)Q87811272‏
100 0 ‎‡a L. Douglas Case‏ ‎‡c researcher‏ ‎‡9 en‏
400 0 ‎‡a L Doug Case‏ ‎‡c wetenschapper‏ ‎‡9 nl‏
670 ‎‡a Author's 120 Assessment of wall motion score index by dobutamine cardiovascular magnetic resonance predicts future cardiac events in patients with mild to moderate, but not severe reduction of left ventricular ejection fraction‏
670 ‎‡a Author's A comparison of radial, brachial, and aortic pressures after cardiopulmonary bypass‏
670 ‎‡a Author's A Comparison of Smoking History in the Electronic Health Record With Self-Report‏
670 ‎‡a Author's A comparison of treatment outcomes for black patients and white patients with metastatic breast cancer. The Piedmont Oncology Association experience.‏
670 ‎‡a Author's A genome-wide genotyping study in patients with ischaemic stroke: initial analysis and data release‏
670 ‎‡a Author's A multi-site randomized clinical trial to reduce suicidal ideation in suicidal adult outpatients with Major Depressive Disorder: Development of a methodology to enhance safety.‏
670 ‎‡a Author's A phase I dose escalation study of hypofractionated IMRT field-in-field boost for newly diagnosed glioblastoma multiforme.‏
670 ‎‡a Author's A phase II study of dibromodulcitol‏
670 ‎‡a Author's A phase II study of dibromodulcitol (DBD) in stage IV melanoma‏
670 ‎‡a Author's A phase II trial of thalidomide and procarbazine in adult patients with recurrent or progressive malignant gliomas.‏
670 ‎‡a Author's A phase III, double-blind, placebo-controlled prospective randomized clinical trial of d-threo-methylphenidate HCl in brain tumor patients receiving radiation therapy‏
670 ‎‡a Author's A Pilot, Randomized Clinical Trial of Bedtime Doses of Prazosin Versus Placebo in Suicidal Posttraumatic Stress Disorder Patients With Nightmares‏
670 ‎‡a Author's A prospective, randomized, double-blind controlled trial of acetaminophen and diphenhydramine pretransfusion medication versus placebo for the prevention of transfusion reactions‏
670 ‎‡a Author's A randomized, controlled trial of Panax quinquefolius extract (CVT-E002) to reduce respiratory infection in patients with chronic lymphocytic leukemia‏
670 ‎‡a Author's A randomized, double-blind, placebo-controlled study of oral coenzyme Q10 to relieve self-reported treatment-related fatigue in newly diagnosed patients with breast cancer‏
670 ‎‡a Author's A Randomized Double-Blind Placebo-Controlled Trial of Fruit and Vegetable Concentrates on Intermediate Biomarkers in Head and Neck Cancer‏
670 ‎‡a Author's A randomized trial of adjuvant chemotherapy and immunotherapy in Stage I and Stage II cutaneous melanoma. An interim report‏
670 ‎‡a Author's ACES (Accelerated Chest Pain Evaluation With Stress Imaging) Protocols Eliminate Testing Disparities in Patients With Chest Pain‏
670 ‎‡a Author's Adherence to Guidelines for Youths With Diabetes Mellitus‏
670 ‎‡a Author's Age-related longitudinal changes in depressive symptoms following breast cancer diagnosis and treatment‏
670 ‎‡a Author's Analysis of salivary fluid and chemosensory functions in patients treated for primary malignant brain tumors‏
670 ‎‡a Author's Association Between Inflammatory Biomarker C-Reactive Protein and Radiotherapy-Induced Early Adverse Skin Reactions in a Multiracial/Ethnic Breast Cancer Population‏
670 ‎‡a Author's Association of type 1 diabetes with month of birth among U.S. youth: The SEARCH for Diabetes in Youth Study‏
670 ‎‡a Author's Avoidable utilization of the chest pain observation unit: evaluation of very-low-risk patients‏
670 ‎‡a Author's Bedtime doses of prazosin do not affect daytime salivary amylase markers in PTSD‏
670 ‎‡a Author's BMI influences prognosis following surgery and adjuvant chemotherapy for lymph node positive breast cancer‏
670 ‎‡a Author's Breast cancer screening education in the workplace‏
670 ‎‡a Author's Breast cancer subtype affects patterns of failure of brain metastases after treatment with stereotactic radiosurgery‏
670 ‎‡a Author's Candidate gene polymorphisms for ischemic stroke‏
670 ‎‡a Author's Caregiver reports of provider recommended frequency of blood glucose monitoring and actual testing frequency for youth with type 1 diabetes‏
670 ‎‡a Author's CCNU in combination chemotherapy for advanced histologically unfavorable non-Hodgkin's lymphoma‏
670 ‎‡a Author's Chemotherapy of metastatic breast cancer in the elderly. The Piedmont Oncology Association experience [see comment].‏
670 ‎‡a Author's Clinic-Based Interventions to Promote Breast and Cervical Cancer Screening‏
670 ‎‡a Author's Cognitive functioning following brain irradiation as part of cancer treatment: Characterizing better cognitive performance‏
670 ‎‡a Author's Combination chemotherapy (5-fluorouracil, methyl-CCNU, mitomycin C) versus 5-fluorouracil alone for advanced previously untreated colorectal carcinoma. A phase III study of the Piedmont Oncology Association‏
670 ‎‡a Author's Comparison of the prognostic significance of the electrocardiographic QRS/T angles in predicting incident coronary heart disease and total mortality (from the atherosclerosis risk in communities study).‏
670 ‎‡a Author's Determination of qualitative telomerase activity as an adjunct to the diagnosis of pancreatic adenocarcinoma by EUS-guided fine-needle aspiration.‏
670 ‎‡a Author's Dietary calcium intake and supplement use among older African American, white, and Native American women in a rural southeastern community‏
670 ‎‡a Author's Differences in arachidonic acid levels and fatty acid desaturase (FADS) gene variants in African Americans and European Americans with diabetes or the metabolic syndrome‏
670 ‎‡a Author's Diffuse malignant mesothelioma of the peritoneum and pleura, analysis of markers‏
670 ‎‡a Author's Disparities in barriers to follow-up care between African American and White breast cancer survivors.‏
670 ‎‡a Author's DNA damage and breast cancer risk‏
670 ‎‡a Author's DNA-repair genetic polymorphisms and breast cancer risk‏
670 ‎‡a Author's Donepezil for Irradiated Brain Tumor Survivors: A Phase III Randomized Placebo-Controlled Clinical Trial.‏
670 ‎‡a Author's Early anticoagulation peak and rapid distribution after intravenous heparin‏
670 ‎‡a Author's Effect of a Digital Health Intervention on Receipt of Colorectal Cancer Screening in Vulnerable Patients: A Randomized Controlled Trial‏
670 ‎‡a Author's Effect of a multifaceted, church-based wellness program on metabolic syndrome in 41 overweight or obese congregants.‏
670 ‎‡a Author's Effect of ArginMax on sexual functioning and quality of life among female cancer survivors: results of the WFU CCOP Research Base Protocol 97106.‏
670 ‎‡a Author's Effect of dietary fatty acids on inflammatory gene expression in healthy humans‏
670 ‎‡a Author's Effect of massage technique on sentinel lymph node mapping for cancer of the breast.‏
670 ‎‡a Author's Effectiveness of a web-based colorectal cancer screening patient decision aid: a randomized controlled trial in a mixed-literacy population‏
670 ‎‡a Author's Effects of weight regain following intentional weight loss on glucoregulatory function in overweight and obese adults with pre-diabetes‏
670 ‎‡a Author's Efficacy and safety of monoclonal anti-CD20 antibody (rituximab) for the treatment of patients with recurrent low-grade non-Hodgkin's lymphoma after high-dose chemotherapy and autologous hematopoietic cell transplantation‏
670 ‎‡a Author's Efficacy of noninvasive transcutaneous cardiac pacing patients undergoing cardiac surgery‏
670 ‎‡a Author's Electrocardiographic and clinical predictors separating atherosclerotic sudden cardiac death from incident coronary heart disease‏
670 ‎‡a Author's Ethnic distribution of ECG predictors of atrial fibrillation and its impact on understanding the ethnic distribution of ischemic stroke in the Atherosclerosis Risk in Communities‏
670 ‎‡a Author's Ethnic distribution of ECG predictors of atrial fibrillation and its impact on understanding the ethnic distribution of ischemic stroke in the Atherosclerosis Risk in Communities (ARIC) study‏
670 ‎‡a Author's Factors predicting survival after intraperitoneal hyperthermic chemotherapy with mitomycin C after cytoreductive surgery for patients with peritoneal carcinomatosis‏
670 ‎‡a Author's Gender differences between the Minnesota code and Novacode electrocardiographic prognostication of coronary heart disease in the cardiovascular health study‏
670 ‎‡a Author's Genetic regulation of ionizing radiation sensitivity and breast cancer risk.‏
670 ‎‡a Author's Health education to increase screening for cervical cancer among Lumbee Indian women in North Carolina‏
670 ‎‡a Author's HEART Pathway Accelerated Diagnostic Protocol Implementation: Prospective Pre-Post Interrupted Time Series Design and Methods‏
670 ‎‡a Author's Heparin management protocol for cardiopulmonary bypass influences postoperative heparin rebound but not bleeding‏
670 ‎‡a Author's High-dose 24-hour infusion of 5-fluorouracil in metastatic prostate cancer. A phase II trial of the Piedmont Oncology Association.‏
670 ‎‡a Author's High- versus standard-dose megestrol acetate in women with advanced breast cancer: a phase III trial of the Piedmont Oncology Association‏
670 ‎‡a Author's Hypnotic Medications and Suicide: Risk, Mechanisms, Mitigation, and the FDA.‏
670 ‎‡a Author's Impact of restricting enrollment in stroke genetics research to adults able to provide informed consent‏
670 ‎‡a Author's Impact of rural residence on forgoing healthcare after cancer because of cost.‏
670 ‎‡a Author's Improved tolerance of vincristine by glutamic acid. A preliminary report‏
670 ‎‡a Author's Improvement of long-term survival in extensive small-cell lung cancer‏
670 ‎‡a Author's Incidence and time course of bleeding after long-term amenorrhea after breast cancer treatment: a prospective study‏
670 ‎‡a Author's Incidence, time course, and determinants of menstrual bleeding after breast cancer treatment: a prospective study‏
670 ‎‡a Author's Interobserver agreement in the trial of org 10172 in acute stroke treatment classification of stroke based on retrospective medical record review‏
670 ‎‡a Author's Interpreting Measures of Treatment Effect in Cancer Clinical Trials‏
670 ‎‡a Author's Interrupted versus continuous chemotherapy in patients with metastatic breast cancer. The Piedmont Oncology Association‏
670 ‎‡a Author's Intervention to increase screening mammography among women 65 and older‏
670 ‎‡a Author's Intraoperative imprint cytologic evaluation of sentinel lymph nodes for lobular carcinoma of the breast‏
670 ‎‡a Author's Leucovorin and high-dose fluorouracil in metastatic prostate cancer. A phase II trial of the piedmont Oncology Association‏
670 ‎‡a Author's Long-term follow-up of a phase II trial studying a weekly doxorubicin-based multiple drug adjuvant therapy for stage II node-positive carcinoma of the breast‏
670 ‎‡a Author's Long-term Weight Loss Maintenance in the Continuation of a Randomized Diabetes Prevention Translational Study: The Healthy Living Partnerships to Prevent Diabetes (HELP PD) Continuation Trial‏
670 ‎‡a Author's Lung Cancer Screening Benefits and Harms Stratified by Patient Risk: Information to Improve Patient Decision Aids‏
670 ‎‡a Author's Menogaril in the treatment of relapsed multiple myeloma. A phase II trial of the Cancer Center of Wake Forest University‏
670 ‎‡a Author's Mild cognitive impairment in long-term brain tumor survivors following brain irradiation‏
670 ‎‡a Author's National Institute on Aging /Alzheimer's Association criteria for Mild Cognitive Impairment applied to chemotherapy treated breast cancer survivors‏
670 ‎‡a Author's Nightmares and dysfunctional beliefs about sleep mediate the effect of insomnia symptoms on suicidal ideation.‏
670 ‎‡a Author's Perceptions of follow-up care in women with breast cancer‏
670 ‎‡a Author's Performance of the maximum modified early warning score to predict the need for higher care utilization among admitted emergency department patients‏
670 ‎‡a Author's Phase I and pharmacologic study of sequential topotecan-carboplatin-etoposide in patients with extensive stage small cell lung cancer‏
670 ‎‡a Author's Phase I study of lenalidomide in solid tumors‏
670 ‎‡a Author's Phase I study of N-‏
670 ‎‡a Author's Phase I study of N-(phosphonacetyl)-L-aspartate with fluorouracil and with or without dipyridamole in patients with advanced cancer‏
670 ‎‡a Author's Phase Ia/Ib chemo-radiation trial of gemcitabine and dose-escalated thoracic radiation in patients with stage III A/B non-small cell lung cancer.‏
670 ‎‡a Author's Phase II double-blind placebo-controlled randomized study of armodafinil for brain radiation-induced fatigue‏
670 ‎‡a Author's Phase II study of carboplatin, irinotecan, and thalidomide in patients with advanced non-small cell lung cancer‏
670 ‎‡a Author's Phase II study of Ginkgo biloba in irradiated brain tumor patients: effect on cognitive function, quality of life, and mood‏
670 ‎‡a Author's Phase II trial of induction gemcitabine/CPT-11 followed by a twice-weekly infusion of gemcitabine and concurrent external beam radiation for the treatment of locally advanced pancreatic cancer‏
670 ‎‡a Author's Phosphodiesterase 4D and 5-lipoxygenase activating protein in ischemic stroke‏
670 ‎‡a Author's Polymorphisms in drug metabolism genes, smoking, and p53 mutations in breast cancer.‏
670 ‎‡a Author's Polymorphisms of XRCC1 and XRCC3 genes and susceptibility to breast cancer‏
670 ‎‡a Author's Predicted risk of coronary heart disease among persons with type 2 diabetes‏
670 ‎‡a Author's Prediction of cardiac events in patients with reduced left ventricular ejection fraction with dobutamine cardiovascular magnetic resonance assessment of wall motion score index‏
670 ‎‡a Author's Predictors of posttraumatic growth in women with breast cancer‏
670 ‎‡a Author's Preoperative and Intraoperative Predictors of Inotropic Support and Long-Term Outcome in Patients Having Coronary Artery Bypass Grafting‏
670 ‎‡a Author's Prevalence of obstructive sleep apnea in suicidal patients with major depressive disorder‏
670 ‎‡a Author's Prevalence of tobacco use and association between cardiometabolic risk factors and cigarette smoking in youth with type 1 or type 2 diabetes mellitus‏
670 ‎‡a Author's Problems Experienced by Ovarian Cancer Survivors During Treatment‏
670 ‎‡a Author's Projections of type 1 and type 2 diabetes burden in the U.S. population aged <20 years through 2050: dynamic modeling of incidence, mortality, and population growth‏
670 ‎‡a Author's Quality of diets consumed by older rural adults‏
670 ‎‡a Author's Quality of life of irradiated brain tumor survivors treated with donepezil or placebo: Results of the WFU CCOP research base protocol 91105‏
670 ‎‡a Author's Racial/Ethnic disparities in health care receipt among male cancer survivors‏
670 ‎‡a Author's Randomized comparison of observation unit plus stress cardiac MRI and hospital admission‏
670 ‎‡a Author's Receptivity of a worksite breast cancer screening education program‏
670 ‎‡a Author's Reducing Suicidal Ideation Through Insomnia Treatment (REST-IT): A Randomized Clinical Trial‏
670 ‎‡a Author's Reduction in observation unit length of stay with coronary computed tomography angiography depends on time of emergency department presentation‏
670 ‎‡a Author's Response by Mahler et al to Letter Regarding Article, "Safely Identifying Emergency Department Patients With Acute Chest Pain for Early Discharge: HEART Pathway Accelerated Diagnostic Protocol" ‏
670 ‎‡a Author's Rural-urban differences in health behaviors and implications for health status among US cancer survivors‏
670 ‎‡a Author's Rural-urban disparities in health status among US cancer survivors‏
670 ‎‡a Author's Safely Identifying Emergency Department Patients With Acute Chest Pain for Early Discharge‏
670 ‎‡a Author's Schedule-selective biochemical modulation of 5-fluorouracil in advanced colorectal cancer--a phase II study‏
670 ‎‡a Author's Self-reported adherence and biomarker levels of CoQ10 and Alpha -tocopherol.‏
670 ‎‡a Author's Sentinel lymph node intraoperative imprint cytology in patients with breast cancer-costly or cost effective?‏
670 ‎‡a Author's Sex differences in stroke evaluations in the Ischemic Stroke Genetics Study‏
670 ‎‡a Author's Sex differences in stroke severity, symptoms, and deficits after first-ever ischemic stroke‏
670 ‎‡a Author's Sexual problems in younger women after breast cancer surgery‏
670 ‎‡a Author's Single agent vincristine by infusion in refractory multiple myeloma‏
670 ‎‡a Author's Sleep histories are seldom documented on a general medical service.‏
670 ‎‡a Author's Smokeless tobacco use accelerates age-related loss of bone mineral density among older women in a multi-ethnic rural community‏
670 ‎‡a Author's Stress cardiac magnetic resonance imaging with observation unit care reduces cost for patients with emergent chest pain: a randomized trial‏
670 ‎‡a Author's Stress CMR imaging observation unit in the emergency department reduces 1-year medical care costs in patients with acute chest pain: a randomized study for comparison with inpatient care‏
670 ‎‡a Author's Stress CMR reduces revascularization, hospital readmission, and recurrent cardiac testing in intermediate-risk patients with acute chest pain‏
670 ‎‡a Author's Structural genomic variation in ischemic stroke‏
670 ‎‡a Author's Supportive use of megestrol acetate‏
670 ‎‡a Author's Supportive use of megestrol acetate (Megace) with head/neck and lung cancer patients receiving radiation therapy‏
670 ‎‡a Author's Symptom clusters in patients with newly-diagnosed brain tumors‏
670 ‎‡a Author's Tamoxifen as initial endocrine therapy for metastatic breast cancer: long term follow-up of two Piedmont Oncology Association (POA) trials‏
670 ‎‡a Author's Tamoxifen versus high-dose oral medroxyprogesterone acetate as initial endocrine therapy for patients with metastatic breast cancer: a Piedmont Oncology Association study‏
670 ‎‡a Author's The 24-month metabolic benefits of the healthy living partnerships to prevent diabetes: A community-based translational study.‏
670 ‎‡a Author's The effects of race and region on cardiovascular morbidity among elderly Americans with diabetes‏
670 ‎‡a Author's The epidemiology of arm and hand swelling in premenopausal breast cancer survivors‏
670 ‎‡a Author's The healthy living partnerships to prevent diabetes and the diabetes prevention program: a comparison of year 1 and 2 intervention results‏
670 ‎‡a Author's The impact of FADS genetic variants on ω6 polyunsaturated fatty acid metabolism in African Americans‏
670 ‎‡a Author's The impact of polyunsaturated fatty acid-based dietary supplements on disease biomarkers in a metabolic syndrome/diabetes population‏
670 ‎‡a Author's The relation of flow cytometry to clinical and biologic characteristics in women with node negative primary breast cancer‏
670 ‎‡a Author's The relationship of person-specific eveningness chronotype, greater seasonality, and less rhythmicity to suicidal behavior: A literature review‏
670 ‎‡a Author's The use of flow cytometry for the prognosis of stage II adjuvant treated breast cancer patients‏
670 ‎‡a Author's The YMCA Healthy, Fit, and Strong Program: a community-based, family-centered, low-cost obesity prevention/treatment pilot study‏
670 ‎‡a Author's Tobacco use in a tri-ethnic population of older women in southeastern North Carolina‏
670 ‎‡a Author's Trajectories of depressive symptoms following breast cancer diagnosis‏
670 ‎‡a Author's Trajectories of illness intrusiveness domains following a diagnosis of breast cancer‏
670 ‎‡a Author's Trajectories of Posttraumatic Growth and Associated Characteristics in Women with Breast Cancer‏
670 ‎‡a Author's Transition from pediatric to adult care for youth diagnosed with type 1 diabetes in adolescence‏
670 ‎‡a Author's Usability of a Novel Mobile Health iPad App by Vulnerable Populations.‏
670 ‎‡a Author's Validation of self-reported breast and cervical cancer screening tests among low-income minority women‏
670 ‎‡a Author's Variability of the activated coagulation time‏
670 ‎‡a Author's Vitamin and mineral supplement use by older rural adults‏
670 ‎‡a Author's VP-16-213 in combination chemotherapy with chest irradiation for small-cell lung cancer: a randomized trial of the Piedmont Oncology Association‏
670 ‎‡a Author's Weight Loss Intervention in Survivors of ER/PR-negative Breast Cancer‏
670 ‎‡a Author's Whole body FDG-PET for the evaluation and staging of small cell lung cancer: a preliminary study‏
670 ‎‡a wikidata authority control‏ ‎‡u https://viaf.org/viaf/75384020‏
670 ‎‡a wikidata authority control‏ ‎‡u https://viaf.org/processed/LC|n 87911227‏
909 ‎‡a (orcid) 0000000257064377‏ ‎‡9 1‏
919 ‎‡a ethnicdistributionofecgpredictorsofatrialfibrillationanditsimpactonunderstandingtheethnicdistributionofischemicstrokeintheatherosclerosisriskincommunitiesaricstudy‏ ‎‡A Ethnic distribution of ECG predictors of atrial fibrillation and its impact on understanding the ethnic distribution of ischemic stroke in the Atherosclerosis Risk in Communities (ARIC) study‏ ‎‡9 1‏
919 ‎‡a ethnicdistributionofecgpredictorsofatrialfibrillationanditsimpactonunderstandingtheethnicdistributionofischemicstrokeintheatherosclerosisriskincommunities‏ ‎‡A Ethnic distribution of ECG predictors of atrial fibrillation and its impact on understanding the ethnic distribution of ischemic stroke in the Atherosclerosis Risk in Communities‏ ‎‡9 1‏
919 ‎‡a electrocardiographicandclinicalpredictorsseparatingatheroscleroticsuddencardiacdeathfromincidentcoronaryheartdisease‏ ‎‡A Electrocardiographic and clinical predictors separating atherosclerotic sudden cardiac death from incident coronary heart disease‏ ‎‡9 1‏
919 ‎‡a predictorsofposttraumaticgrowthinwomenwithbreastcancer‏ ‎‡A Predictors of posttraumatic growth in women with breast cancer‏ ‎‡9 1‏
919 ‎‡a preoperativeandintraoperativepredictorsofinotropicsupportandlongtermoutcomeinpatientshavingcoronaryarterybypassgrafting‏ ‎‡A Preoperative and Intraoperative Predictors of Inotropic Support and Long-Term Outcome in Patients Having Coronary Artery Bypass Grafting‏ ‎‡9 1‏
919 ‎‡a prevalenceofobstructivesleepapneainsuicidalpatientswithmajordepressivedisorder‏ ‎‡A Prevalence of obstructive sleep apnea in suicidal patients with major depressive disorder‏ ‎‡9 1‏
919 ‎‡a prevalenceoftobaccouseandassociationbetweencardiometabolicriskfactorsandcigarettesmokinginyouthwithtype1ortype2diabetesmellitus‏ ‎‡A Prevalence of tobacco use and association between cardiometabolic risk factors and cigarette smoking in youth with type 1 or type 2 diabetes mellitus‏ ‎‡9 1‏
919 ‎‡a problemsexperiencedbyovariancancersurvivorsduringtreatment‏ ‎‡A Problems Experienced by Ovarian Cancer Survivors During Treatment‏ ‎‡9 1‏
919 ‎‡a projectionsoftype1andtype2diabetesburdenintheuspopulationaged20yearsthrough2050dynamicmodelingofincidencemortalityandpopulationgrowth‏ ‎‡A Projections of type 1 and type 2 diabetes burden in the U.S. population aged <20 years through 2050: dynamic modeling of incidence, mortality, and population growth‏ ‎‡9 1‏
919 ‎‡a qualityofdietsconsumedbyolderruraladults‏ ‎‡A Quality of diets consumed by older rural adults‏ ‎‡9 1‏
919 ‎‡a phase1studyoflenalidomideinsolidtumors‏ ‎‡A Phase I study of lenalidomide in solid tumors‏ ‎‡9 1‏
919 ‎‡a epidemiologyofarmandhandswellinginpremenopausalbreastcancersurvivors‏ ‎‡A The epidemiology of arm and hand swelling in premenopausal breast cancer survivors‏ ‎‡9 1‏
919 ‎‡a effectsofraceandregiononcardiovascularmorbidityamongelderlyamericanswithdiabetes‏ ‎‡A The effects of race and region on cardiovascular morbidity among elderly Americans with diabetes‏ ‎‡9 1‏
919 ‎‡a 24monthmetabolicbenefitsofthehealthylivingpartnershipstopreventdiabetesacommunitybasedtranslationalstudy‏ ‎‡A The 24-month metabolic benefits of the healthy living partnerships to prevent diabetes: A community-based translational study.‏ ‎‡9 1‏
919 ‎‡a tamoxifenversushighdoseoralmedroxyprogesteroneacetateasinitialendocrinetherapyforpatientswithmetastaticbreastcancerapiedmontoncologyassociationstudy‏ ‎‡A Tamoxifen versus high-dose oral medroxyprogesterone acetate as initial endocrine therapy for patients with metastatic breast cancer: a Piedmont Oncology Association study‏ ‎‡9 1‏
919 ‎‡a tamoxifenasinitialendocrinetherapyformetastaticbreastcancerlongtermfollowupof2piedmontoncologyassociationpoatrials‏ ‎‡A Tamoxifen as initial endocrine therapy for metastatic breast cancer: long term follow-up of two Piedmont Oncology Association (POA) trials‏ ‎‡9 1‏
919 ‎‡a phase1studyofn‏ ‎‡A Phase I study of N-‏ ‎‡9 1‏
919 ‎‡a efficacyofnoninvasivetranscutaneouscardiacpacingpatientsundergoingcardiacsurgery‏ ‎‡A Efficacy of noninvasive transcutaneous cardiac pacing patients undergoing cardiac surgery‏ ‎‡9 1‏
919 ‎‡a efficacyandsafetyofmonoclonalanticd20antibodyrituximabforthetreatmentofpatientswithrecurrentlowgradenonhodgkinslymphomaafterhighdosechemotherapyandautologoushematopoieticcelltransplantation‏ ‎‡A Efficacy and safety of monoclonal anti-CD20 antibody (rituximab) for the treatment of patients with recurrent low-grade non-Hodgkin's lymphoma after high-dose chemotherapy and autologous hematopoietic cell transplantation‏ ‎‡9 1‏
919 ‎‡a effectsofweightregainfollowingintentionalweightlossonglucoregulatoryfunctioninoverweightandobeseadultswithprediabetes‏ ‎‡A Effects of weight regain following intentional weight loss on glucoregulatory function in overweight and obese adults with pre-diabetes‏ ‎‡9 1‏
919 ‎‡a effectivenessofawebbasedcolorectalcancerscreeningpatientdecisionaidarandomizedcontrolledtrialinamixedliteracypopulation‏ ‎‡A Effectiveness of a web-based colorectal cancer screening patient decision aid: a randomized controlled trial in a mixed-literacy population‏ ‎‡9 1‏
919 ‎‡a symptomclustersinpatientswithnewlydiagnosedbraintumors‏ ‎‡A Symptom clusters in patients with newly-diagnosed brain tumors‏ ‎‡9 1‏
919 ‎‡a supportiveuseofmegestrolacetatemegacewithheadneckandlungcancerpatientsreceivingradiationtherapy‏ ‎‡A Supportive use of megestrol acetate (Megace) with head/neck and lung cancer patients receiving radiation therapy‏ ‎‡9 1‏
919 ‎‡a phase1studyofnphosphonacetyl50aspartatewithfluorouracilandwithorwithoutdipyridamoleinpatientswithadvancedcancer‏ ‎‡A Phase I study of N-(phosphonacetyl)-L-aspartate with fluorouracil and with or without dipyridamole in patients with advanced cancer‏ ‎‡9 1‏
919 ‎‡a supportiveuseofmegestrolacetate‏ ‎‡A Supportive use of megestrol acetate‏ ‎‡9 1‏
919 ‎‡a structuralgenomicvariationinischemicstroke‏ ‎‡A Structural genomic variation in ischemic stroke‏ ‎‡9 1‏
919 ‎‡a determinationofqualitativetelomeraseactivityasanadjuncttothediagnosisofpancreaticadenocarcinomabyeusguidedfineneedleaspiration‏ ‎‡A Determination of qualitative telomerase activity as an adjunct to the diagnosis of pancreatic adenocarcinoma by EUS-guided fine-needle aspiration.‏ ‎‡9 1‏
919 ‎‡a comparisonoftheprognosticsignificanceoftheelectrocardiographicqrstanglesinpredictingincidentcoronaryheartdiseaseandtotalmortalityfromtheatherosclerosisriskincommunitiesstudy‏ ‎‡A Comparison of the prognostic significance of the electrocardiographic QRS/T angles in predicting incident coronary heart disease and total mortality (from the atherosclerosis risk in communities study).‏ ‎‡9 1‏
919 ‎‡a combinationchemotherapy5fluorouracilmethylccnumitomycin100versus5fluorouracilaloneforadvancedpreviouslyuntreatedcolorectalcarcinomaaphase3studyofthepiedmontoncologyassociation‏ ‎‡A Combination chemotherapy (5-fluorouracil, methyl-CCNU, mitomycin C) versus 5-fluorouracil alone for advanced previously untreated colorectal carcinoma. A phase III study of the Piedmont Oncology Association‏ ‎‡9 1‏
919 ‎‡a cognitivefunctioningfollowingbrainirradiationaspartofcancertreatmentcharacterizingbettercognitiveperformance‏ ‎‡A Cognitive functioning following brain irradiation as part of cancer treatment: Characterizing better cognitive performance‏ ‎‡9 1‏
919 ‎‡a effectofmassagetechniqueonsentinellymphnodemappingforcancerofthebreast‏ ‎‡A Effect of massage technique on sentinel lymph node mapping for cancer of the breast.‏ ‎‡9 1‏
919 ‎‡a clinicbasedinterventionstopromotebreastandcervicalcancerscreening‏ ‎‡A Clinic-Based Interventions to Promote Breast and Cervical Cancer Screening‏ ‎‡9 1‏
919 ‎‡a phaseiaibchemoradiationtrialofgemcitabineanddoseescalatedthoracicradiationinpatientswithstage3abnonsmallcelllungcancer‏ ‎‡A Phase Ia/Ib chemo-radiation trial of gemcitabine and dose-escalated thoracic radiation in patients with stage III A/B non-small cell lung cancer.‏ ‎‡9 1‏
919 ‎‡a phase2doubleblindplacebocontrolledrandomizedstudyofarmodafinilforbrainradiationinducedfatigue‏ ‎‡A Phase II double-blind placebo-controlled randomized study of armodafinil for brain radiation-induced fatigue‏ ‎‡9 1‏
919 ‎‡a prospectiverandomizeddoubleblindcontrolledtrialofacetaminophenanddiphenhydraminepretransfusionmedicationversusplaceboforthepreventionoftransfusionreactions‏ ‎‡A A prospective, randomized, double-blind controlled trial of acetaminophen and diphenhydramine pretransfusion medication versus placebo for the prevention of transfusion reactions‏ ‎‡9 1‏
919 ‎‡a phase2studyofcarboplatinirinotecanandthalidomideinpatientswithadvancednonsmallcelllungcancer‏ ‎‡A Phase II study of carboplatin, irinotecan, and thalidomide in patients with advanced non-small cell lung cancer‏ ‎‡9 1‏
919 ‎‡a randomizedcontrolledtrialofpanaxquinquefoliusextractcvte002toreducerespiratoryinfectioninpatientswithchroniclymphocyticleukemia‏ ‎‡A A randomized, controlled trial of Panax quinquefolius extract (CVT-E002) to reduce respiratory infection in patients with chronic lymphocytic leukemia‏ ‎‡9 1‏
919 ‎‡a randomizeddoubleblindplacebocontrolledstudyoforalcoenzymeq10torelieveselfreportedtreatmentrelatedfatigueinnewlydiagnosedpatientswithbreastcancer‏ ‎‡A A randomized, double-blind, placebo-controlled study of oral coenzyme Q10 to relieve self-reported treatment-related fatigue in newly diagnosed patients with breast cancer‏ ‎‡9 1‏
919 ‎‡a randomizeddoubleblindplacebocontrolledtrialoffruitandvegetableconcentratesonintermediatebiomarkersinheadandneckcancer‏ ‎‡A A Randomized Double-Blind Placebo-Controlled Trial of Fruit and Vegetable Concentrates on Intermediate Biomarkers in Head and Neck Cancer‏ ‎‡9 1‏
919 ‎‡a transitionfrompediatrictoadultcareforyouthdiagnosedwithtype1diabetesinadolescence‏ ‎‡A Transition from pediatric to adult care for youth diagnosed with type 1 diabetes in adolescence‏ ‎‡9 1‏
919 ‎‡a stresscmrreducesrevascularizationhospitalreadmissionandrecurrentcardiactestinginintermediateriskpatientswithacutechestpain‏ ‎‡A Stress CMR reduces revascularization, hospital readmission, and recurrent cardiac testing in intermediate-risk patients with acute chest pain‏ ‎‡9 1‏
919 ‎‡a stresscmrimagingobservationunitintheemergencydepartmentreduces1yearmedicalcarecostsinpatientswithacutechestpainarandomizedstudyforcomparisonwithinpatientcare‏ ‎‡A Stress CMR imaging observation unit in the emergency department reduces 1-year medical care costs in patients with acute chest pain: a randomized study for comparison with inpatient care‏ ‎‡9 1‏
919 ‎‡a interpretingmeasuresoftreatmenteffectincancerclinicaltrials‏ ‎‡A Interpreting Measures of Treatment Effect in Cancer Clinical Trials‏ ‎‡9 1‏
919 ‎‡a stresscardiacmagneticresonanceimagingwithobservationunitcarereducescostforpatientswithemergentchestpainarandomizedtrial‏ ‎‡A Stress cardiac magnetic resonance imaging with observation unit care reduces cost for patients with emergent chest pain: a randomized trial‏ ‎‡9 1‏
919 ‎‡a factorspredictingsurvivalafterintraperitonealhyperthermicchemotherapywithmitomycin100aftercytoreductivesurgeryforpatientswithperitonealcarcinomatosis‏ ‎‡A Factors predicting survival after intraperitoneal hyperthermic chemotherapy with mitomycin C after cytoreductive surgery for patients with peritoneal carcinomatosis‏ ‎‡9 1‏
919 ‎‡a genderdifferencesbetweentheminnesotacodeandnovacodeelectrocardiographicprognosticationofcoronaryheartdiseaseinthecardiovascularhealthstudy‏ ‎‡A Gender differences between the Minnesota code and Novacode electrocardiographic prognostication of coronary heart disease in the cardiovascular health study‏ ‎‡9 1‏
919 ‎‡a interobserveragreementinthetrialoforg10172inacutestroketreatmentclassificationofstrokebasedonretrospectivemedicalrecordreview‏ ‎‡A Interobserver agreement in the trial of org 10172 in acute stroke treatment classification of stroke based on retrospective medical record review‏ ‎‡9 1‏
919 ‎‡a smokelesstobaccouseacceleratesagerelatedlossofbonemineraldensityamongolderwomeninamultiethnicruralcommunity‏ ‎‡A Smokeless tobacco use accelerates age-related loss of bone mineral density among older women in a multi-ethnic rural community‏ ‎‡9 1‏
919 ‎‡a sleephistoriesareseldomdocumentedonageneralmedicalservice‏ ‎‡A Sleep histories are seldom documented on a general medical service.‏ ‎‡9 1‏
919 ‎‡a singleagentvincristinebyinfusioninrefractorymultiplemyeloma‏ ‎‡A Single agent vincristine by infusion in refractory multiple myeloma‏ ‎‡9 1‏
919 ‎‡a sexualproblemsinyoungerwomenafterbreastcancersurgery‏ ‎‡A Sexual problems in younger women after breast cancer surgery‏ ‎‡9 1‏
919 ‎‡a sexdifferencesinstrokeseveritysymptomsanddeficitsafter1everischemicstroke‏ ‎‡A Sex differences in stroke severity, symptoms, and deficits after first-ever ischemic stroke‏ ‎‡9 1‏
919 ‎‡a chemotherapyofmetastaticbreastcancerintheelderlythepiedmontoncologyassociationexperience‏ ‎‡A Chemotherapy of metastatic breast cancer in the elderly. The Piedmont Oncology Association experience [see comment].‏ ‎‡9 1‏
919 ‎‡a ccnuincombinationchemotherapyforadvancedhistologicallyunfavorablenonhodgkinslymphoma‏ ‎‡A CCNU in combination chemotherapy for advanced histologically unfavorable non-Hodgkin's lymphoma‏ ‎‡9 1‏
919 ‎‡a caregiverreportsofproviderrecommendedfrequencyofbloodglucosemonitoringandactualtestingfrequencyforyouthwithtype1diabetes‏ ‎‡A Caregiver reports of provider recommended frequency of blood glucose monitoring and actual testing frequency for youth with type 1 diabetes‏ ‎‡9 1‏
919 ‎‡a candidategenepolymorphismsforischemicstroke‏ ‎‡A Candidate gene polymorphisms for ischemic stroke‏ ‎‡9 1‏
919 ‎‡a breastcancersubtypeaffectspatternsoffailureofbrainmetastasesaftertreatmentwithstereotacticradiosurgery‏ ‎‡A Breast cancer subtype affects patterns of failure of brain metastases after treatment with stereotactic radiosurgery‏ ‎‡9 1‏
919 ‎‡a healthylivingpartnershipstopreventdiabetesandthediabetespreventionprogramacomparisonofyear1and2interventionresults‏ ‎‡A The healthy living partnerships to prevent diabetes and the diabetes prevention program: a comparison of year 1 and 2 intervention results‏ ‎‡9 1‏
919 ‎‡a variabilityoftheactivatedcoagulationtime‏ ‎‡A Variability of the activated coagulation time‏ ‎‡9 1‏
919 ‎‡a incidencetimecourseanddeterminantsofmenstrualbleedingafterbreastcancertreatmentaprospectivestudy‏ ‎‡A Incidence, time course, and determinants of menstrual bleeding after breast cancer treatment: a prospective study‏ ‎‡9 1‏
919 ‎‡a incidenceandtimecourseofbleedingafterlongtermamenorrheaafterbreastcancertreatmentaprospectivestudy‏ ‎‡A Incidence and time course of bleeding after long-term amenorrhea after breast cancer treatment: a prospective study‏ ‎‡9 1‏
919 ‎‡a improvementoflongtermsurvivalinextensivesmallcelllungcancer‏ ‎‡A Improvement of long-term survival in extensive small-cell lung cancer‏ ‎‡9 1‏
919 ‎‡a improvedtoleranceofvincristinebyglutamicacidapreliminaryreport‏ ‎‡A Improved tolerance of vincristine by glutamic acid. A preliminary report‏ ‎‡9 1‏
919 ‎‡a impactofruralresidenceonforgoinghealthcareaftercancerbecauseofcost‏ ‎‡A Impact of rural residence on forgoing healthcare after cancer because of cost.‏ ‎‡9 1‏
919 ‎‡a validationofselfreportedbreastandcervicalcancerscreeningtestsamonglowincomeminoritywomen‏ ‎‡A Validation of self-reported breast and cervical cancer screening tests among low-income minority women‏ ‎‡9 1‏
919 ‎‡a breastcancerscreeningeducationintheworkplace‏ ‎‡A Breast cancer screening education in the workplace‏ ‎‡9 1‏
919 ‎‡a bmiinfluencesprognosisfollowingsurgeryandadjuvantchemotherapyforlymphnodepositivebreastcancer‏ ‎‡A BMI influences prognosis following surgery and adjuvant chemotherapy for lymph node positive breast cancer‏ ‎‡9 1‏
919 ‎‡a bedtimedosesofprazosindonotaffectdaytimesalivaryamylasemarkersin PTSD ‏ ‎‡A Bedtime doses of prazosin do not affect daytime salivary amylase markers in PTSD‏ ‎‡9 1‏
919 ‎‡a pilotrandomizedclinicaltrialofbedtimedosesofprazosinversusplaceboinsuicidalposttraumaticstressdisorderpatientswithnightmares‏ ‎‡A A Pilot, Randomized Clinical Trial of Bedtime Doses of Prazosin Versus Placebo in Suicidal Posttraumatic Stress Disorder Patients With Nightmares‏ ‎‡9 1‏
919 ‎‡a phase3doubleblindplacebocontrolledprospectiverandomizedclinicaltrialof500threomethylphenidatehclinbraintumorpatientsreceivingradiationtherapy‏ ‎‡A A phase III, double-blind, placebo-controlled prospective randomized clinical trial of d-threo-methylphenidate HCl in brain tumor patients receiving radiation therapy‏ ‎‡9 1‏
919 ‎‡a impactofrestrictingenrollmentinstrokegeneticsresearchtoadultsabletoprovideinformedconsent‏ ‎‡A Impact of restricting enrollment in stroke genetics research to adults able to provide informed consent‏ ‎‡9 1‏
919 ‎‡a phase2trialofthalidomideandprocarbazineinadultpatientswithrecurrentorprogressivemalignantgliomas‏ ‎‡A A phase II trial of thalidomide and procarbazine in adult patients with recurrent or progressive malignant gliomas.‏ ‎‡9 1‏
919 ‎‡a sexdifferencesinstrokeevaluationsintheischemicstrokegeneticsstudy‏ ‎‡A Sex differences in stroke evaluations in the Ischemic Stroke Genetics Study‏ ‎‡9 1‏
919 ‎‡a impactoffadsgeneticvariantsonω6polyunsaturatedfattyacidmetabolisminafricanamericans‏ ‎‡A The impact of FADS genetic variants on ω6 polyunsaturated fatty acid metabolism in African Americans‏ ‎‡9 1‏
919 ‎‡a interruptedversuscontinuouschemotherapyinpatientswithmetastaticbreastcancerthepiedmontoncologyassociation‏ ‎‡A Interrupted versus continuous chemotherapy in patients with metastatic breast cancer. The Piedmont Oncology Association‏ ‎‡9 1‏
919 ‎‡a interventiontoincreasescreeningmammographyamongwomen65andolder‏ ‎‡A Intervention to increase screening mammography among women 65 and older‏ ‎‡9 1‏
919 ‎‡a wholebodyfdgpetfortheevaluationandstagingofsmallcelllungcancerapreliminarystudy‏ ‎‡A Whole body FDG-PET for the evaluation and staging of small cell lung cancer: a preliminary study‏ ‎‡9 1‏
919 ‎‡a avoidableutilizationofthechestpainobservationunitevaluationofverylowriskpatients‏ ‎‡A Avoidable utilization of the chest pain observation unit: evaluation of very-low-risk patients‏ ‎‡9 1‏
919 ‎‡a weightlossinterventioninsurvivorsoferprnegativebreastcancer‏ ‎‡A Weight Loss Intervention in Survivors of ER/PR-negative Breast Cancer‏ ‎‡9 1‏
919 ‎‡a associationoftype1diabeteswithmonthofbirthamongusyouththesearchfordiabetesinyouthstudy‏ ‎‡A Association of type 1 diabetes with month of birth among U.S. youth: The SEARCH for Diabetes in Youth Study‏ ‎‡9 1‏
919 ‎‡a associationbetweeninflammatorybiomarker100reactiveproteinandradiotherapyinducedearlyadverseskinreactionsinamultiracialethnicbreastcancerpopulation‏ ‎‡A Association Between Inflammatory Biomarker C-Reactive Protein and Radiotherapy-Induced Early Adverse Skin Reactions in a Multiracial/Ethnic Breast Cancer Population‏ ‎‡9 1‏
919 ‎‡a vp16213incombinationchemotherapywithchestirradiationforsmallcelllungcancerarandomizedtrialofthepiedmontoncologyassociation‏ ‎‡A VP-16-213 in combination chemotherapy with chest irradiation for small-cell lung cancer: a randomized trial of the Piedmont Oncology Association‏ ‎‡9 1‏
919 ‎‡a analysisofsalivaryfluidandchemosensoryfunctionsinpatientstreatedforprimarymalignantbraintumors‏ ‎‡A Analysis of salivary fluid and chemosensory functions in patients treated for primary malignant brain tumors‏ ‎‡9 1‏
919 ‎‡a predictionofcardiaceventsinpatientswithreducedleftventricularejectionfractionwithdobutaminecardiovascularmagneticresonanceassessmentofwallmotionscoreindex‏ ‎‡A Prediction of cardiac events in patients with reduced left ventricular ejection fraction with dobutamine cardiovascular magnetic resonance assessment of wall motion score index‏ ‎‡9 1‏
919 ‎‡a geneticregulationofionizingradiationsensitivityandbreastcancerrisk‏ ‎‡A Genetic regulation of ionizing radiation sensitivity and breast cancer risk.‏ ‎‡9 1‏
919 ‎‡a qualityoflifeofirradiatedbraintumorsurvivorstreatedwithdonepezilorplaceboresultsofthewfuccopresearchbaseprotocol91105‏ ‎‡A Quality of life of irradiated brain tumor survivors treated with donepezil or placebo: Results of the WFU CCOP research base protocol 91105‏ ‎‡9 1‏
919 ‎‡a trajectoriesofposttraumaticgrowthandassociatedcharacteristicsinwomenwithbreastcancer‏ ‎‡A Trajectories of Posttraumatic Growth and Associated Characteristics in Women with Breast Cancer‏ ‎‡9 1‏
919 ‎‡a impactofpolyunsaturatedfattyacidbaseddietarysupplementsondiseasebiomarkersinametabolicsyndromediabetespopulation‏ ‎‡A The impact of polyunsaturated fatty acid-based dietary supplements on disease biomarkers in a metabolic syndrome/diabetes population‏ ‎‡9 1‏
919 ‎‡a vitaminandmineralsupplementusebyolderruraladults‏ ‎‡A Vitamin and mineral supplement use by older rural adults‏ ‎‡9 1‏
919 ‎‡a hypnoticmedicationsandsuicideriskmechanismsmitigationandthefda‏ ‎‡A Hypnotic Medications and Suicide: Risk, Mechanisms, Mitigation, and the FDA.‏ ‎‡9 1‏
919 ‎‡a highversusstandarddosemegestrolacetateinwomenwithadvancedbreastcanceraphase3trialofthepiedmontoncologyassociation‏ ‎‡A High- versus standard-dose megestrol acetate in women with advanced breast cancer: a phase III trial of the Piedmont Oncology Association‏ ‎‡9 1‏
919 ‎‡a racialethnicdisparitiesinhealthcarereceiptamongmalecancersurvivors‏ ‎‡A Racial/Ethnic disparities in health care receipt among male cancer survivors‏ ‎‡9 1‏
919 ‎‡a intraoperativeimprintcytologicevaluationofsentinellymphnodesforlobularcarcinomaofthebreast‏ ‎‡A Intraoperative imprint cytologic evaluation of sentinel lymph nodes for lobular carcinoma of the breast‏ ‎‡9 1‏
919 ‎‡a relationofflowcytometrytoclinicalandbiologiccharacteristicsinwomenwithnodenegativeprimarybreastcancer‏ ‎‡A The relation of flow cytometry to clinical and biologic characteristics in women with node negative primary breast cancer‏ ‎‡9 1‏
919 ‎‡a leucovorinandhighdosefluorouracilinmetastaticprostatecanceraphase2trialofthepiedmontoncologyassociation‏ ‎‡A Leucovorin and high-dose fluorouracil in metastatic prostate cancer. A phase II trial of the piedmont Oncology Association‏ ‎‡9 1‏
919 ‎‡a longtermfollowupofaphase2trialstudyingaweeklydoxorubicinbasedmultipledrugadjuvanttherapyforstage2nodepositivecarcinomaofthebreast‏ ‎‡A Long-term follow-up of a phase II trial studying a weekly doxorubicin-based multiple drug adjuvant therapy for stage II node-positive carcinoma of the breast‏ ‎‡9 1‏
919 ‎‡a relationshipofpersonspecificeveningnesschronotypegreaterseasonalityandlessrhythmicitytosuicidalbehavioraliteraturereview‏ ‎‡A The relationship of person-specific eveningness chronotype, greater seasonality, and less rhythmicity to suicidal behavior: A literature review‏ ‎‡9 1‏
919 ‎‡a useofflowcytometryfortheprognosisofstage2adjuvanttreatedbreastcancerpatients‏ ‎‡A The use of flow cytometry for the prognosis of stage II adjuvant treated breast cancer patients‏ ‎‡9 1‏
919 ‎‡a ymcahealthyfitandstrongprogramacommunitybasedfamilycenteredlowcostobesitypreventiontreatmentpilotstudy‏ ‎‡A The YMCA Healthy, Fit, and Strong Program: a community-based, family-centered, low-cost obesity prevention/treatment pilot study‏ ‎‡9 1‏
919 ‎‡a randomizedcomparisonofobservationunitplusstresscardiacmriandhospitaladmission‏ ‎‡A Randomized comparison of observation unit plus stress cardiac MRI and hospital admission‏ ‎‡9 1‏
919 ‎‡a receptivityofaworksitebreastcancerscreeningeducationprogram‏ ‎‡A Receptivity of a worksite breast cancer screening education program‏ ‎‡9 1‏
919 ‎‡a 120assessmentofwallmotionscoreindexbydobutaminecardiovascularmagneticresonancepredictsfuturecardiaceventsinpatientswithmildtomoderatebutnotseverereductionofleftventricularejectionfraction‏ ‎‡A 120 Assessment of wall motion score index by dobutamine cardiovascular magnetic resonance predicts future cardiac events in patients with mild to moderate, but not severe reduction of left ventricular ejection fraction‏ ‎‡9 1‏
919 ‎‡a comparisonofradialbrachialandaorticpressuresaftercardiopulmonarybypass‏ ‎‡A A comparison of radial, brachial, and aortic pressures after cardiopulmonary bypass‏ ‎‡9 1‏
919 ‎‡a reducingsuicidalideationthroughinsomniatreatmentrestitarandomizedclinicaltrial‏ ‎‡A Reducing Suicidal Ideation Through Insomnia Treatment (REST-IT): A Randomized Clinical Trial‏ ‎‡9 1‏
919 ‎‡a comparisonofsmokinghistoryintheelectronichealthrecordwithselfreport‏ ‎‡A A Comparison of Smoking History in the Electronic Health Record With Self-Report‏ ‎‡9 1‏
919 ‎‡a comparisonoftreatmentoutcomesforblackpatientsandwhitepatientswithmetastaticbreastcancerthepiedmontoncologyassociationexperience‏ ‎‡A A comparison of treatment outcomes for black patients and white patients with metastatic breast cancer. The Piedmont Oncology Association experience.‏ ‎‡9 1‏
919 ‎‡a reductioninobservationunitlengthofstaywithcoronarycomputedtomographyangiographydependsontimeofemergencydepartmentpresentation‏ ‎‡A Reduction in observation unit length of stay with coronary computed tomography angiography depends on time of emergency department presentation‏ ‎‡9 1‏
919 ‎‡a tobaccouseinatriethnicpopulationofolderwomeninsoutheasternnorthcarolina‏ ‎‡A Tobacco use in a tri-ethnic population of older women in southeastern North Carolina‏ ‎‡9 1‏
919 ‎‡a usabilityofanovelmobilehealthipadappbyvulnerablepopulations‏ ‎‡A Usability of a Novel Mobile Health iPad App by Vulnerable Populations.‏ ‎‡9 1‏
919 ‎‡a effectofdietaryfattyacidsoninflammatorygeneexpressioninhealthyhumans‏ ‎‡A Effect of dietary fatty acids on inflammatory gene expression in healthy humans‏ ‎‡9 1‏
919 ‎‡a trajectoriesofdepressivesymptomsfollowingbreastcancerdiagnosis‏ ‎‡A Trajectories of depressive symptoms following breast cancer diagnosis‏ ‎‡9 1‏
919 ‎‡a trajectoriesofillnessintrusivenessdomainsfollowingadiagnosisofbreastcancer‏ ‎‡A Trajectories of illness intrusiveness domains following a diagnosis of breast cancer‏ ‎‡9 1‏
919 ‎‡a effectofarginmaxonsexualfunctioningandqualityoflifeamongfemalecancersurvivorsresultsofthewfuccopresearchbaseprotocol97106‏ ‎‡A Effect of ArginMax on sexual functioning and quality of life among female cancer survivors: results of the WFU CCOP Research Base Protocol 97106.‏ ‎‡9 1‏
919 ‎‡a longtermweightlossmaintenanceinthecontinuationofarandomizeddiabetespreventiontranslationalstudythehealthylivingpartnershipstopreventdiabeteshelppdcontinuationtrial‏ ‎‡A Long-term Weight Loss Maintenance in the Continuation of a Randomized Diabetes Prevention Translational Study: The Healthy Living Partnerships to Prevent Diabetes (HELP PD) Continuation Trial‏ ‎‡9 1‏
919 ‎‡a lungcancerscreeningbenefitsandharmsstratifiedbypatientriskinformationtoimprovepatientdecisionaids‏ ‎‡A Lung Cancer Screening Benefits and Harms Stratified by Patient Risk: Information to Improve Patient Decision Aids‏ ‎‡9 1‏
919 ‎‡a responsebymahleretaltoletterregardingarticlesafelyidentifyingemergencydepartmentpatientswithacutechestpainforearlydischargeheartpathwayaccelerateddiagnosticprotocol‏ ‎‡A Response by Mahler et al to Letter Regarding Article, "Safely Identifying Emergency Department Patients With Acute Chest Pain for Early Discharge: HEART Pathway Accelerated Diagnostic Protocol" ‏ ‎‡9 1‏
919 ‎‡a highdose24hourinfusionof5fluorouracilinmetastaticprostatecanceraphase2trialofthepiedmontoncologyassociation‏ ‎‡A High-dose 24-hour infusion of 5-fluorouracil in metastatic prostate cancer. A phase II trial of the Piedmont Oncology Association.‏ ‎‡9 1‏
919 ‎‡a effectofamultifacetedchurchbasedwellnessprogramonmetabolicsyndromein41overweightorobesecongregants‏ ‎‡A Effect of a multifaceted, church-based wellness program on metabolic syndrome in 41 overweight or obese congregants.‏ ‎‡9 1‏
919 ‎‡a effectofadigitalhealthinterventiononreceiptofcolorectalcancerscreeninginvulnerablepatientsarandomizedcontrolledtrial‏ ‎‡A Effect of a Digital Health Intervention on Receipt of Colorectal Cancer Screening in Vulnerable Patients: A Randomized Controlled Trial‏ ‎‡9 1‏
919 ‎‡a earlyanticoagulationpeakandrapiddistributionafterintravenousheparin‏ ‎‡A Early anticoagulation peak and rapid distribution after intravenous heparin‏ ‎‡9 1‏
919 ‎‡a donepezilforirradiatedbraintumorsurvivorsaphase3randomizedplacebocontrolledclinicaltrial‏ ‎‡A Donepezil for Irradiated Brain Tumor Survivors: A Phase III Randomized Placebo-Controlled Clinical Trial.‏ ‎‡9 1‏
919 ‎‡a dnarepairgeneticpolymorphismsandbreastcancerrisk‏ ‎‡A DNA-repair genetic polymorphisms and breast cancer risk‏ ‎‡9 1‏
919 ‎‡a dnadamageandbreastcancerrisk‏ ‎‡A DNA damage and breast cancer risk‏ ‎‡9 1‏
919 ‎‡a disparitiesinbarrierstofollowupcarebetweenafricanamericanandwhitebreastcancersurvivors‏ ‎‡A Disparities in barriers to follow-up care between African American and White breast cancer survivors.‏ ‎‡9 1‏
919 ‎‡a diffusemalignantmesotheliomaoftheperitoneumandpleuraanalysisofmarkers‏ ‎‡A Diffuse malignant mesothelioma of the peritoneum and pleura, analysis of markers‏ ‎‡9 1‏
919 ‎‡a differencesinarachidonicacidlevelsandfattyaciddesaturasefadsgenevariantsinafricanamericansandeuropeanamericanswithdiabetesorthemetabolicsyndrome‏ ‎‡A Differences in arachidonic acid levels and fatty acid desaturase (FADS) gene variants in African Americans and European Americans with diabetes or the metabolic syndrome‏ ‎‡9 1‏
919 ‎‡a dietarycalciumintakeandsupplementuseamongolderafricanamericanwhiteandnativeamericanwomeninaruralsoutheasterncommunity‏ ‎‡A Dietary calcium intake and supplement use among older African American, white, and Native American women in a rural southeastern community‏ ‎‡9 1‏
919 ‎‡a heparinmanagementprotocolforcardiopulmonarybypassinfluencespostoperativeheparinreboundbutnotbleeding‏ ‎‡A Heparin management protocol for cardiopulmonary bypass influences postoperative heparin rebound but not bleeding‏ ‎‡9 1‏
919 ‎‡a menogarilinthetreatmentofrelapsedmultiplemyelomaaphase2trialofthecancercenterofwakeforestuniversity‏ ‎‡A Menogaril in the treatment of relapsed multiple myeloma. A phase II trial of the Cancer Center of Wake Forest University‏ ‎‡9 1‏
919 ‎‡a genomewidegenotypingstudyinpatientswithischaemicstrokeinitialanalysisanddatarelease‏ ‎‡A A genome-wide genotyping study in patients with ischaemic stroke: initial analysis and data release‏ ‎‡9 1‏
919 ‎‡a heartpathwayaccelerateddiagnosticprotocolimplementationprospectiveprepostinterruptedtimeseriesdesignandmethods‏ ‎‡A HEART Pathway Accelerated Diagnostic Protocol Implementation: Prospective Pre-Post Interrupted Time Series Design and Methods‏ ‎‡9 1‏
919 ‎‡a multisiterandomizedclinicaltrialtoreducesuicidalideationinsuicidaladultoutpatientswithmajordepressivedisorderdevelopmentofamethodologytoenhancesafety‏ ‎‡A A multi-site randomized clinical trial to reduce suicidal ideation in suicidal adult outpatients with Major Depressive Disorder: Development of a methodology to enhance safety.‏ ‎‡9 1‏
919 ‎‡a ruralurbandifferencesinhealthbehaviorsandimplicationsforhealthstatusamonguscancersurvivors‏ ‎‡A Rural-urban differences in health behaviors and implications for health status among US cancer survivors‏ ‎‡9 1‏
919 ‎‡a phase1doseescalationstudyofhypofractionatedimrtfieldinfieldboostfornewlydiagnosedglioblastomamultiforme‏ ‎‡A A phase I dose escalation study of hypofractionated IMRT field-in-field boost for newly diagnosed glioblastoma multiforme.‏ ‎‡9 1‏
919 ‎‡a phase2studyofdibromodulcitol‏ ‎‡A A phase II study of dibromodulcitol‏ ‎‡9 1‏
919 ‎‡a sentinellymphnodeintraoperativeimprintcytologyinpatientswithbreastcancercostlyorcosteffective‏ ‎‡A Sentinel lymph node intraoperative imprint cytology in patients with breast cancer-costly or cost effective?‏ ‎‡9 1‏
919 ‎‡a healtheducationtoincreasescreeningforcervicalcanceramonglumbeeindianwomeninnorthcarolina‏ ‎‡A Health education to increase screening for cervical cancer among Lumbee Indian women in North Carolina‏ ‎‡9 1‏
919 ‎‡a selfreportedadherenceandbiomarkerlevelsofcoq10and Alpha tocopherol‏ ‎‡A Self-reported adherence and biomarker levels of CoQ10 and Alpha -tocopherol.‏ ‎‡9 1‏
919 ‎‡a mildcognitiveimpairmentinlongtermbraintumorsurvivorsfollowingbrainirradiation‏ ‎‡A Mild cognitive impairment in long-term brain tumor survivors following brain irradiation‏ ‎‡9 1‏
919 ‎‡a nationalinstituteonagingalzheimersassociationcriteriaformildcognitiveimpairmentappliedtochemotherapytreatedbreastcancersurvivors‏ ‎‡A National Institute on Aging /Alzheimer's Association criteria for Mild Cognitive Impairment applied to chemotherapy treated breast cancer survivors‏ ‎‡9 1‏
919 ‎‡a nightmaresanddysfunctionalbeliefsaboutsleepmediatetheeffectofinsomniasymptomsonsuicidalideation‏ ‎‡A Nightmares and dysfunctional beliefs about sleep mediate the effect of insomnia symptoms on suicidal ideation.‏ ‎‡9 1‏
919 ‎‡a perceptionsoffollowupcareinwomenwithbreastcancer‏ ‎‡A Perceptions of follow-up care in women with breast cancer‏ ‎‡9 1‏
919 ‎‡a phase2studyofdibromodulcitoldbdinstage4melanoma‏ ‎‡A A phase II study of dibromodulcitol (DBD) in stage IV melanoma‏ ‎‡9 1‏
919 ‎‡a performanceofthemaximummodifiedearlywarningscoretopredicttheneedforhighercareutilizationamongadmittedemergencydepartmentpatients‏ ‎‡A Performance of the maximum modified early warning score to predict the need for higher care utilization among admitted emergency department patients‏ ‎‡9 1‏
919 ‎‡a scheduleselectivebiochemicalmodulationof5fluorouracilinadvancedcolorectalcanceraphase2study‏ ‎‡A Schedule-selective biochemical modulation of 5-fluorouracil in advanced colorectal cancer--a phase II study‏ ‎‡9 1‏
919 ‎‡a predictedriskofcoronaryheartdiseaseamongpersonswithtype2diabetes‏ ‎‡A Predicted risk of coronary heart disease among persons with type 2 diabetes‏ ‎‡9 1‏
919 ‎‡a polymorphismsofxrcc1andxrcc3genesandsusceptibilitytobreastcancer‏ ‎‡A Polymorphisms of XRCC1 and XRCC3 genes and susceptibility to breast cancer‏ ‎‡9 1‏
919 ‎‡a polymorphismsindrugmetabolismgenessmokingandp53mutationsinbreastcancer‏ ‎‡A Polymorphisms in drug metabolism genes, smoking, and p53 mutations in breast cancer.‏ ‎‡9 1‏
919 ‎‡a phosphodiesterase4dand5lipoxygenaseactivatingproteininischemicstroke‏ ‎‡A Phosphodiesterase 4D and 5-lipoxygenase activating protein in ischemic stroke‏ ‎‡9 1‏
919 ‎‡a phase1andpharmacologicstudyofsequentialtopotecancarboplatinetoposideinpatientswithextensivestagesmallcelllungcancer‏ ‎‡A Phase I and pharmacologic study of sequential topotecan-carboplatin-etoposide in patients with extensive stage small cell lung cancer‏ ‎‡9 1‏
919 ‎‡a phase2trialofinductiongemcitabinecpt11followedbyatwiceweeklyinfusionofgemcitabineandconcurrentexternalbeamradiationforthetreatmentoflocallyadvancedpancreaticcancer‏ ‎‡A Phase II trial of induction gemcitabine/CPT-11 followed by a twice-weekly infusion of gemcitabine and concurrent external beam radiation for the treatment of locally advanced pancreatic cancer‏ ‎‡9 1‏
919 ‎‡a phase2studyofginkgobilobainirradiatedbraintumorpatientseffectoncognitivefunctionqualityoflifeandmood‏ ‎‡A Phase II study of Ginkgo biloba in irradiated brain tumor patients: effect on cognitive function, quality of life, and mood‏ ‎‡9 1‏
919 ‎‡a agerelatedlongitudinalchangesindepressivesymptomsfollowingbreastcancerdiagnosisandtreatment‏ ‎‡A Age-related longitudinal changes in depressive symptoms following breast cancer diagnosis and treatment‏ ‎‡9 1‏
919 ‎‡a adherencetoguidelinesforyouthswithdiabetesmellitus‏ ‎‡A Adherence to Guidelines for Youths With Diabetes Mellitus‏ ‎‡9 1‏
919 ‎‡a ruralurbandisparitiesinhealthstatusamonguscancersurvivors‏ ‎‡A Rural-urban disparities in health status among US cancer survivors‏ ‎‡9 1‏
919 ‎‡a safelyidentifyingemergencydepartmentpatientswithacutechestpainforearlydischarge‏ ‎‡A Safely Identifying Emergency Department Patients With Acute Chest Pain for Early Discharge‏ ‎‡9 1‏
919 ‎‡a acesacceleratedchestpainevaluationwithstressimagingprotocolseliminatetestingdisparitiesinpatientswithchestpain‏ ‎‡A ACES (Accelerated Chest Pain Evaluation With Stress Imaging) Protocols Eliminate Testing Disparities in Patients With Chest Pain‏ ‎‡9 1‏
919 ‎‡a randomizedtrialofadjuvantchemotherapyandimmunotherapyinstage1andstage2cutaneousmelanomaaninterimreport‏ ‎‡A A randomized trial of adjuvant chemotherapy and immunotherapy in Stage I and Stage II cutaneous melanoma. An interim report‏ ‎‡9 1‏
996 ‎‡2 CAOONL|ncf10442363‏
996 ‎‡2 ISNI|0000000033599508‏
996 ‎‡2 ISNI|0000000037728477‏
996 ‎‡2 ISNI|0000000454419149‏
996 ‎‡2 LC|no2024029319‏
996 ‎‡2 ISNI|0000000037193302‏
996 ‎‡2 J9U|987007374143305171‏
996 ‎‡2 ISNI|0000000123529773‏
996 ‎‡2 LC|n 2004072467‏
996 ‎‡2 ISNI|0000000384264566‏
996 ‎‡2 DNB|134135865‏
996 ‎‡2 NII|DA04420132‏
996 ‎‡2 CAOONL|ncf12095310‏
996 ‎‡2 SZ|1128344246‏
996 ‎‡2 LC|n 2007010138‏
996 ‎‡2 LC|no2009008158‏
996 ‎‡2 LC|n 85050047‏
996 ‎‡2 DNB|1014788811‏
996 ‎‡2 SUDOC|067112226‏
996 ‎‡2 LC|n 00005106‏
996 ‎‡2 NUKAT|n 00015559‏
996 ‎‡2 DNB|1056439556‏
996 ‎‡2 LC|no2005119440‏
996 ‎‡2 BNF|13328326‏
996 ‎‡2 ISNI|000000004849694X‏
996 ‎‡2 JPG|500012872‏
996 ‎‡2 J9U|987007271659505171‏
996 ‎‡2 LC|no2020095112‏
996 ‎‡2 LC|no 98027784‏
996 ‎‡2 ISNI|0000000371435362‏
996 ‎‡2 ISNI|0000000050622984‏
996 ‎‡2 LC|nr 93005893‏
996 ‎‡2 NSK|000562064‏
996 ‎‡2 LC|n 2015072553‏
996 ‎‡2 CAOONL|ncf10347648‏
996 ‎‡2 BNF|16726074‏
996 ‎‡2 NDL|00687586‏
996 ‎‡2 ISNI|0000000073935158‏
996 ‎‡2 DNB|1019408057‏
996 ‎‡2 ISNI|0000000025157689‏
996 ‎‡2 J9U|987007300903505171‏
996 ‎‡2 DNB|1098160940‏
996 ‎‡2 LC|no 97046047‏
996 ‎‡2 LC|n 96008592‏
996 ‎‡2 NUKAT|n 01094145‏
996 ‎‡2 RERO|A018795256‏
996 ‎‡2 BNC|981058523620206706‏
996 ‎‡2 LC|n 2015052679‏
996 ‎‡2 ISNI|0000000025488621‏
996 ‎‡2 ISNI|0000000027096234‏
996 ‎‡2 ISNI|0000000079686826‏
996 ‎‡2 LC|n 2005170332‏
996 ‎‡2 LIH|LNB:V-58150;=BF‏
996 ‎‡2 DNB|110418916X‏
996 ‎‡2 LC|no2010078534‏
996 ‎‡2 ISNI|0000000434913748‏
996 ‎‡2 LC|no 93036493‏
996 ‎‡2 ISNI|0000000382574704‏
996 ‎‡2 LNB|LNC10-000111176‏
996 ‎‡2 BLBNB|000206811‏
996 ‎‡2 LC|no 94044015‏
996 ‎‡2 DNB|1157405770‏
996 ‎‡2 LC|n 87872088‏
996 ‎‡2 BNC|981058524835706706‏
996 ‎‡2 DBC|87097969416411‏
996 ‎‡2 CAOONL|ncf10431776‏
996 ‎‡2 NII|DA11859395‏
996 ‎‡2 ISNI|0000000368601323‏
996 ‎‡2 SUDOC|086045210‏
996 ‎‡2 ISNI|0000000083026441‏
996 ‎‡2 LC|no2024039576‏
996 ‎‡2 ISNI|0000000377255661‏
996 ‎‡2 PLWABN|9810618532805606‏
996 ‎‡2 NII|DA11054770‏
996 ‎‡2 LC|n 85171027‏
996 ‎‡2 PLWABN|9814279246905606‏
996 ‎‡2 LC|n 88084077‏
996 ‎‡2 LC|n 87126326‏
996 ‎‡2 JPG|500104741‏
996 ‎‡2 ISNI|0000000117307971‏
996 ‎‡2 PLWABN|9810646730705606‏
996 ‎‡2 LC|n 87140353‏
996 ‎‡2 SUDOC|078800730‏
996 ‎‡2 ISNI|0000000027169990‏
996 ‎‡2 LC|no2017067749‏
996 ‎‡2 NSK|000061245‏
996 ‎‡2 NUKAT|n 2023047961‏
996 ‎‡2 ISNI|0000000074367906‏
996 ‎‡2 ISNI|0000000115884185‏
996 ‎‡2 LC|n 93090820‏
996 ‎‡2 LC|n 50034451‏
996 ‎‡2 SELIBR|395883‏
996 ‎‡2 LC|n 94088367‏
996 ‎‡2 LC|n 87911227‏
996 ‎‡2 N6I|vtls001213585‏
996 ‎‡2 SUDOC|074685384‏
996 ‎‡2 ISNI|0000000061418161‏
996 ‎‡2 SUDOC|060967269‏
996 ‎‡2 ISNI|0000000436970770‏
996 ‎‡2 SUDOC|127295410‏
996 ‎‡2 BNF|15613218‏
996 ‎‡2 SUDOC|050117882‏
996 ‎‡2 LC|no2012084264‏
996 ‎‡2 ISNI|0000000083384695‏
996 ‎‡2 ISNI|000000006535621X‏
996 ‎‡2 LC|n 93004858‏
996 ‎‡2 RERO|A010983427‏
996 ‎‡2 SUDOC|089540085‏
996 ‎‡2 ISNI|0000000076858194‏
996 ‎‡2 LC|no2015095335‏
996 ‎‡2 ISNI|0000000388553701‏
996 ‎‡2 NTA|297942956‏
996 ‎‡2 BIBSYS|98002492‏
996 ‎‡2 BIBSYS|1063488‏
996 ‎‡2 LC|no2004087640‏
996 ‎‡2 CAOONL|ncf10095852‏
996 ‎‡2 LC|n 85199659‏
996 ‎‡2 LC|n 2015025771‏
996 ‎‡2 LC|no2007099247‏
996 ‎‡2 KRNLK|KAC200107423‏
996 ‎‡2 LC|n 2018025400‏
996 ‎‡2 BIBSYS|90166226‏
996 ‎‡2 PLWABN|9810578422105606‏
996 ‎‡2 NUKAT|n 2006135385‏
996 ‎‡2 LC|n 95014856‏
996 ‎‡2 NLA|000035135608‏
996 ‎‡2 ISNI|0000000498298502‏
996 ‎‡2 CAOONL|ncf10498212‏
996 ‎‡2 LIH|LNB:BE_u_F;=BY‏
996 ‎‡2 NTA|075056631‏
996 ‎‡2 DNB|1295935066‏
996 ‎‡2 LC|n 50035021‏
996 ‎‡2 ISNI|0000000114116192‏
996 ‎‡2 BIBSYS|9031595‏
996 ‎‡2 NTA|305076701‏
996 ‎‡2 ISNI|0000000041066365‏
996 ‎‡2 NUKAT|n 2007076706‏
996 ‎‡2 LC|n 88010075‏
996 ‎‡2 ISNI|0000000389762679‏
996 ‎‡2 J9U|987007329507005171‏
996 ‎‡2 BIBSYS|6007217‏
996 ‎‡2 LC|no2019063966‏
996 ‎‡2 NKC|jx20080708002‏
996 ‎‡2 J9U|987007319399605171‏
996 ‎‡2 LC|no2012008657‏
996 ‎‡2 LC|no2017124553‏
996 ‎‡2 ISNI|0000000044280332‏
996 ‎‡2 DNB|1306212480‏
996 ‎‡2 ISNI|0000000022967643‏
996 ‎‡2 DNB|1128344246‏
996 ‎‡2 ISNI|0000000080858648‏
996 ‎‡2 NKC|xx0155621‏
996 ‎‡2 ISNI|0000000110053948‏
996 ‎‡2 ISNI|0000000051493619‏
996 ‎‡2 LC|n 85171026‏
996 ‎‡2 LC|no2017101241‏
996 ‎‡2 CAOONL|ncf11357490‏
996 ‎‡2 ISNI|0000000500272687‏
996 ‎‡2 BNF|14499758‏
996 ‎‡2 LC|n 85171029‏
996 ‎‡2 ISNI|0000000075902704‏
996 ‎‡2 ISNI|0000000028389426‏
996 ‎‡2 DNB|1157580157‏
996 ‎‡2 RERO|A003762397‏
996 ‎‡2 J9U|987007426867105171‏
996 ‎‡2 LIH|LNB:BYK_j_;=B_m_‏
996 ‎‡2 CAOONL|ncf10501672‏
996 ‎‡2 ISNI|0000000042668659‏
996 ‎‡2 NDL|00520585‏
996 ‎‡2 DNB|1157970346‏
996 ‎‡2 NUKAT|n 2013138016‏
996 ‎‡2 LC|n 95024383‏
996 ‎‡2 ISNI|0000000002917235‏
996 ‎‡2 LC|n 83016087‏
996 ‎‡2 LC|n 91117441‏
996 ‎‡2 LC|nb2014004080‏
996 ‎‡2 ISNI|0000000037361484‏
996 ‎‡2 LC|nr 93024053‏
996 ‎‡2 SELIBR|180506‏
996 ‎‡2 LNB|LNC10-000160876‏
996 ‎‡2 LC|n 2004066258‏
996 ‎‡2 LC|no2010063326‏
996 ‎‡2 NII|DA06216308‏
996 ‎‡2 LC|n 2002029939‏
996 ‎‡2 NTA|192869655‏
996 ‎‡2 LC|no2021055500‏
996 ‎‡2 RERO|A003081501‏
996 ‎‡2 LC|n 78009160‏
996 ‎‡2 ISNI|0000000498623985‏
996 ‎‡2 NUKAT|n 2008127692‏
996 ‎‡2 CAOONL|ncf11666626‏
996 ‎‡2 NLA|000035026414‏
996 ‎‡2 PLWABN|9810589864905606‏
996 ‎‡2 BIBSYS|90914512‏
996 ‎‡2 BIBSYS|90511982‏
996 ‎‡2 LC|n 82148511‏
996 ‎‡2 KRNLK|KAC200713075‏
996 ‎‡2 LC|n 2010046124‏
996 ‎‡2 LC|n 2010046127‏
996 ‎‡2 BNF|14585941‏
996 ‎‡2 LC|n 87152338‏
996 ‎‡2 RERO|A003081481‏
996 ‎‡2 RERO|A006198840‏
996 ‎‡2 LC|no 00036013‏
996 ‎‡2 NTA|236185020‏
996 ‎‡2 LC|n 91128796‏
996 ‎‡2 LC|n 88286004‏
996 ‎‡2 LC|no2014119074‏
996 ‎‡2 LC|n 00067825‏
996 ‎‡2 ISNI|0000000384500581‏
996 ‎‡2 ISNI|0000000075336925‏
996 ‎‡2 ISNI|0000000019587674‏
996 ‎‡2 LC|n 88602452‏
996 ‎‡2 NUKAT|n 2011153377‏
996 ‎‡2 B2Q|0000474132‏
996 ‎‡2 PLWABN|9810687000205606‏
996 ‎‡2 ISNI|0000000030742735‏
996 ‎‡2 DNB|1026518008‏
996 ‎‡2 BNC|981058618281606706‏
997 ‎‡a 0 0 lived 0 0‏ ‎‡9 1‏
998 ‎‡a Case, Larry Douglas‏ ‎‡2 LC|n 87911227‏ ‎‡3 suggested‏