VIAF

Virtual International Authority File

Search

Leader 00000nz a2200037n 45 0
001 WKP|Q90437729 (VIAF cluster) (Authority/Source Record)
003 WKP
005 20241121000037.0
008 241121nneanz||abbn n and d
035 ‎‡a (WKP)Q90437729‏
024 ‎‡a 0000-0001-5034-3157‏ ‎‡2 orcid‏
035 ‎‡a (OCoLC)Q90437729‏
100 0 ‎‡a জেমস পি হিউজ‏ ‎‡9 bn‏
375 ‎‡a 1‏ ‎‡2 iso5218‏
400 0 ‎‡a James P Hughes‏ ‎‡c researcher (ORCID 0000-0001-5034-3157)‏ ‎‡9 en‏
400 0 ‎‡a James P Hughes‏ ‎‡c wetenschapper‏ ‎‡9 nl‏
670 ‎‡a Author's A Cluster Randomized Evaluation of a Health Department Data to Care Intervention Designed to Increase Engagement in HIV Care and Antiretroviral Use.‏
670 ‎‡a Author's A population-based study to compare treatment outcomes among women with urogenital chlamydial infection in Washington State, 1992-2015.‏
670 ‎‡a Author's A post-trial assessment of factors influencing study drug adherence in a randomized biomedical HIV-1 prevention trial‏
670 ‎‡a Author's A Prospective Cohort Study of Intimate Partner Violence and Unprotected Sex in HIV-Positive Female Sex Workers in Mombasa, Kenya‏
670 ‎‡a Author's A Prospective Study of Intimate Partner Violence as a Risk Factor for Detectable Plasma Viral Load in HIV-Positive Women Engaged in Transactional Sex in Mombasa, Kenya.‏
670 ‎‡a Author's Absence of an association of human polyomavirus and papillomavirus infection with lung cancer in China: a nested case-control study‏
670 ‎‡a Author's Accuracy and cost-effectiveness of cervical cancer screening by high-risk human papillomavirus DNA testing of self-collected vaginal samples‏
670 ‎‡a Author's Acquisition and natural history of human papillomavirus type 16 variant infection among a cohort of female university students‏
670 ‎‡a Author's Acyclovir achieves a lower concentration in African HIV-seronegative, herpes simplex virus 2-seropositive women than in non-African populations‏
670 ‎‡a Author's Acyclovir Prophylaxis Reduces the Incidence of Herpes Zoster Among HIV-Infected Individuals: Results of a Randomized Clinical Trial‏
670 ‎‡a Author's Age- and gender-specific estimates of partnership formation and dissolution rates in the Seattle sex survey‏
670 ‎‡a Author's Age-disparate partnerships and incident HIV infection in adolescent girls and young women in rural South Africa: An HPTN 068 analysis‏
670 ‎‡a Author's Age of diagnosis of squamous cell cervical carcinoma and early sexual experience‏
670 ‎‡a Author's An assessment of the accuracy and availability of data in electronic patient tracking systems for patients receiving HIV treatment in central Mozambique‏
670 ‎‡a Author's An empiric risk scoring tool for identifying high-risk heterosexual HIV-1-serodiscordant couples for targeted HIV-1 prevention‏
670 ‎‡a Author's An evaluation of HIV partner counseling and referral services using new disposition codes‏
670 ‎‡a Author's Analysis of genetic linkage of HIV from couples enrolled in the HIV Prevention Trials Network 052 trial‏
670 ‎‡a Author's Analysis of liquid bead microarray antibody assay data for epidemiologic studies of pathogen-cancer associations‏
670 ‎‡a Author's Antibody responses in oral fluid after administration of prophylactic human papillomavirus vaccines‏
670 ‎‡a Author's Antiretroviral Drug Use and HIV Drug Resistance Among Young Women in Rural South Africa: HPTN 068‏
670 ‎‡a Author's Antiretroviral Drug Use in a Cohort of HIV-Uninfected Women in the United States: HIV Prevention Trials Network 064‏
670 ‎‡a Author's Antiretroviral Medication Adherence and Amplified HIV Transmission Risk Among Sexually Active HIV-Infected Individuals in Three Diverse International Settings‏
670 ‎‡a Author's Assessing risk for HIV infection among adolescent girls in South Africa: an evaluation of the VOICE risk score (HPTN 068)‏
670 ‎‡a Author's Assessing the use of surveillance data to estimate the impact of prevention interventions on HIV incidence in cluster-randomized controlled trials‏
670 ‎‡a Author's Association of Recent Bacterial Vaginosis With Acquisition of Mycoplasma genitalium‏
670 ‎‡a Author's Breast-milk infectivity in human immunodeficiency virus type 1-infected mothers‏
670 ‎‡a Author's Cash Transfers, Young Women's Economic Well-Being, and HIV Risk: Evidence from HPTN 068‏
670 ‎‡a Author's Challenges in the design of HIV prevention trials in the United States‏
670 ‎‡a Author's Changes in DNA Level of Oncogenic Human Papillomaviruses Other Than Types 16 and 18 in Relation to Risk of Cervical Intraepithelial Neoplasia Grades 2 and 3‏
670 ‎‡a Author's Characteristics Associated With Human Immunodeficiency Virus Transmission Networks Involving Adolescent Girls and Young Women in Human Immunodeficiency Virus Prevention Trials Network 068 Study‏
670 ‎‡a Author's Characteristics of Age-Discordant Partnerships Associated With HIV Risk Among Young South African Women (HPTN 068).‏
670 ‎‡a Author's Characteristics of COVID-19 in Homeless Shelters: A Community-Based Surveillance Study‏
670 ‎‡a Author's Characteristics of multiple and concurrent partnerships among women at high risk for HIV infection‏
670 ‎‡a Author's Characterization of HIV Seroconverters in a TDF/FTC PrEP Study: HPTN 067/ADAPT.‏
670 ‎‡a Author's Characterization of IgA response among women with incident HPV 16 infection‏
670 ‎‡a Author's Chlamydia screening coverage estimates derived using healthcare effectiveness data and information system procedures and indirect estimation vary substantially‏
670 ‎‡a Author's Choosing a metric for measurement of pre-exposure prophylaxis‏
670 ‎‡a Author's Circumcision and acquisition of human papillomavirus infection in young men.‏
670 ‎‡a Author's Clandestine induced abortion: prevalence, incidence and risk factors among women in a Latin American country‏
670 ‎‡a Author's Clinical and virologic efficacy of herpes simplex virus type 2 suppression by acyclovir in a multicontinent clinical trial‏
670 ‎‡a Author's Clinical and virologic response to episodic acyclovir for genital ulcers among HIV-1 seronegative, herpes simplex virus type 2 seropositive African women: a randomized, placebo-controlled trial‏
670 ‎‡a Author's Clinical findings among young women with genital human papillomavirus infection‏
670 ‎‡a Author's Comparing Methods for Record Linkage for Public Health Action: Matching Algorithm Validation Study‏
670 ‎‡a Author's Comparison of incident cervical and vulvar/vaginal human papillomavirus infections in newly sexually active young women‏
670 ‎‡a Author's Comparison of oral fluid and serum ELISAs in the determination of IgG response to natural human papillomavirus infection in university women.‏
670 ‎‡a Author's Completion of the tuberculosis care cascade in a community-based HIV linkage-to-care study in South Africa and Uganda‏
670 ‎‡a Author's Concordance of self-collected and clinician-collected swab samples for detecting human papillomavirus DNA in women 18 to 32 years of age.‏
670 ‎‡a Author's Conditional cash transfers and the reduction in partner violence for young women: an investigation of causal pathways using evidence from a randomized experiment in South Africa‏
670 ‎‡a Author's Conditional cash transfers and the reduction in partner violence for young women: an investigation of causal pathways using evidence from a randomized experiment in South Africa (HPTN 068).‏
670 ‎‡a Author's Condom use and the risk of genital human papillomavirus infection in young women‏
670 ‎‡a Author's Contingency management to reduce methamphetamine use and sexual risk among men who have sex with men: a randomized controlled trial‏
670 ‎‡a Author's Correlates of national HIV seroprevalence: an ecologic analysis of 122 developing countries.‏
670 ‎‡a Author's Cross-sectional study of urethral exposures at last sexual episode associated with non-gonococcal urethritis among STD clinic patients‏
670 ‎‡a Author's Daily acyclovir for HIV-1 disease progression in people dually infected with HIV-1 and herpes simplex virus type 2: a randomised placebo-controlled trial‏
670 ‎‡a Author's Daily and non-daily pre-exposure prophylaxis in African women (HPTN 067/ADAPT Cape Town Trial): a randomised, open-label, phase 2 trial‏
670 ‎‡a Author's Daily and Nondaily Oral Preexposure Prophylaxis in Men and Transgender Women Who Have Sex With Men: The Human Immunodeficiency Virus Prevention Trials Network 067/ADAPT Study‏
670 ‎‡a Author's Depression and incident HIV in adolescent girls and young women in HPTN 068: Targets for prevention and mediating factors‏
670 ‎‡a Author's Derivation and Validation of an HIV Risk Prediction Score Among Gay, Bisexual and Other Men Who Have Sex With Men to Inform PrEP Initiation in an STD Clinic Setting‏
670 ‎‡a Author's Detection of Genital HPV Types in Fingertip Samples from Newly Sexually Active Female University Students‏
670 ‎‡a Author's Determinants of cervical cancer rates in developing countries‏
670 ‎‡a Author's Determinants of per-coital-act HIV-1 infectivity among African HIV-1-serodiscordant couples‏
670 ‎‡a Author's Development and duration of human papillomavirus lesions, after initial infection‏
670 ‎‡a Author's Development of Genital Warts after Incident Detection of Human Papillomavirus Infection in Young Men‏
670 ‎‡a Author's Differences in virologic and immunologic response to antiretroviral therapy among HIV-1-infected infants and children‏
670 ‎‡a Author's Difficulties in estimating the male-to-female sexual transmissibility of human papillomavirus infection‏
670 ‎‡a Author's Disclosure of genital human papillomavirus infection to female sex partners by young men.‏
670 ‎‡a Author's Discovery of genetic variants of the kinases that activate tenofovir among individuals in the United States, Thailand, and South Africa: HPTN067.‏
670 ‎‡a Author's Discrete proportional hazards models for mismeasured outcomes‏
670 ‎‡a Author's Does Partner Selection Mediate the Relationship Between School Attendance and HIV/Herpes Simplex Virus-2 Among Adolescent Girls and Young Women in South Africa: An Analysis of HIV Prevention Trials Network 068 Data‏
670 ‎‡a Author's Early natural history of incident, type-specific human papillomavirus infections in newly sexually active young women‏
670 ‎‡a Author's Effect of aciclovir on HIV-1 acquisition in herpes simplex virus 2 seropositive women and men who have sex with men: a randomised, double-blind, placebo-controlled trial‏
670 ‎‡a Author's Effect of acyclovir on HIV-1 set point among herpes simplex virus type 2-seropositive persons during early HIV-1 infection‏
670 ‎‡a Author's Effect of Condom Use on Per-act HSV-2 Transmission Risk in HIV-1, HSV-2-discordant Couples‏
670 ‎‡a Author's Effect of expedited treatment of sex partners on recurrent or persistent gonorrhea or chlamydial infection‏
670 ‎‡a Author's Epidemiology of Human Papillomavirus Detected in the Oral Cavity and Fingernails of Mid-Adult Women‏
670 ‎‡a Author's Estimating duration in partnership studies: issues, methods and examples‏
670 ‎‡a Author's Estimating the efficacy of preexposure prophylaxis for HIV prevention among participants with a threshold level of drug concentration‏
670 ‎‡a Author's Estimating the impact of plasma HIV-1 RNA reductions on heterosexual HIV-1 transmission risk‏
670 ‎‡a Author's Evaluation of a Computer-Based Recruitment System for Enrolling Men Who Have Sex With Men Into an Observational HIV Behavioral Risk Study‏
670 ‎‡a Author's Evaluation of a population-based program of expedited partner therapy for gonorrhea and chlamydial infection‏
670 ‎‡a Author's Evaluation of an emergency department and hospital-based data exchange to improve HIV care engagement and viral suppression‏
670 ‎‡a Author's Evaluation of dry and wet transport of at-home self-collected vaginal swabs for human papillomavirus testing‏
670 ‎‡a Author's Evaluation of human papillomavirus testing in primary screening for cervical abnormalities: comparison of sensitivity, specificity, and frequency of referral‏
670 ‎‡a Author's Evaluation of primary cervical cancer screening with an oncogenic human papillomavirus DNA test and cervical cytologic findings among women who attended family planning clinics in the United States‏
670 ‎‡a Author's Evidence for sample selection effect and Hawthorne effect in behavioural HIV prevention trial among young women in a rural South African community‏
670 ‎‡a Author's Evidence of immune memory 8.5 years following administration of a prophylactic human papillomavirus type 16 vaccine‏
670 ‎‡a Author's Executive function associated with sexual risk in young South African women: Findings from the HPTN 068 cohort.‏
670 ‎‡a Author's Expedited partner therapy: a robust intervention‏
670 ‎‡a Author's Factors associated with oropharyngeal human immunodeficiency virus shedding‏
670 ‎‡a Author's Factors Associated With Sex-Related Pre-exposure Prophylaxis Adherence Among Men Who Have Sex With Men in New York City in HPTN 067‏
670 ‎‡a Author's Frequency and predictors of estimated HIV transmissions and bacterial STI acquisition among HIV-positive patients in HIV care across three continents‏
670 ‎‡a Author's Genital human papillomavirus infection in men: incidence and risk factors in a cohort of university students‏
670 ‎‡a Author's Genital human papillomavirus infection: incidence and risk factors in a cohort of female university students‏
670 ‎‡a Author's Gentamicin Alone Inadequate to Eradicate Neisseria Gonorrhoeae from the Pharynx‏
670 ‎‡a Author's Handheld computers for self-administered sensitive data collection: a comparative study in Peru‏
670 ‎‡a Author's HBV infection in relation to consistent condom use: a population-based study in Peru‏
670 ‎‡a Author's Health facility determinants and trends of ICD-10 outpatient psychiatric consultations across Sofala, Mozambique: time-series analyses from 2012 to 2014.‏
670 ‎‡a Author's High HIV testing uptake and linkage to care in a novel program of home-based HIV counseling and testing with facilitated referral in KwaZulu-Natal, South Africa‏
670 ‎‡a Author's High Rates of Exclusive Breastfeeding in Both Arms of a Peer Counseling Study Promoting EBF Among HIV-Infected Kenyan Women‏
670 ‎‡a Author's Higher concentration of HIV RNA in rectal mucosa secretions than in blood and seminal plasma, among men who have sex with men, independent of antiretroviral therapy‏
670 ‎‡a Author's HIV-1 diversity among young women in rural South Africa: HPTN 068.‏
670 ‎‡a Author's HIV-1, sexually transmitted infections, and sexual behavior trends among men who have sex with men in Lima, Peru.‏
670 ‎‡a Author's HIV acquisition among women from selected areas of the United States: a cohort study‏
670 ‎‡a Author's HIV drug resistance in a cohort of HIV-infected MSM in the United States‏
670 ‎‡a Author's HIV Risk Characteristics Associated with Violence Against Women: A Longitudinal Study Among Women in the United States‏
670 ‎‡a Author's HIV Self-Testing Increases HIV Testing Frequency in High Risk Men Who Have Sex with Men: A Randomized Controlled Trial.‏
670 ‎‡a Author's HIV serosorting in men who have sex with men: is it safe?‏
670 ‎‡a Author's HIV testing frequency among men who have sex with men attending sexually transmitted disease clinics: implications for HIV prevention and surveillance‏
670 ‎‡a Author's Home testing and counselling to reduce HIV incidence in a generalised epidemic setting: a mathematical modelling analysis‏
670 ‎‡a Author's Host genetic and viral determinants of HIV-1 RNA set point among HIV-1 seroconverters from sub-saharan Africa‏
670 ‎‡a Author's HPTN 067/ADAPT: Correlates of Sex-Related Pre-exposure Prophylaxis Adherence, Thai Men Who Have Sex With Men, and Transgender Women, 2012-2013‏
670 ‎‡a Author's HPTN 068: A Randomized Control Trial of a Conditional Cash Transfer to Reduce HIV Infection in Young Women in South Africa-Study Design and Baseline Results‏
670 ‎‡a Author's HPTN 078: High Prevalence of HCV Antibodies Among Urban U.S. Men Who Have Sex with Men (MSM) Independent of HIV Status‏
670 ‎‡a Author's Human Immunodeficiency Virus Is Associated With Higher Levels of Systemic Inflammation Among Kenyan Adults Despite Viral Suppression‏
670 ‎‡a Author's Human Papillomavirus (HPV) type 16 and type 18 DNA Loads at Baseline and Persistence of Type-Specific Infection during a 2-year follow-up‏
670 ‎‡a Author's Human papillomavirus type 16 viral load in relation to HIV infection, cervical neoplasia and cancer in Senegal.‏
670 ‎‡a Author's Implementation and Operational Research: Active Referral of Children of HIV-Positive Adults Reveals High Prevalence of Undiagnosed HIV.‏
670 ‎‡a Author's Improvements in the HIV care continuum needed to meaningfully reduce HIV incidence among men who have sex with men in Baltimore, US: a modelling study for HPTN 078‏
670 ‎‡a Author's In what circumstances could nondaily preexposure prophylaxis for HIV substantially reduce program costs?‏
670 ‎‡a Author's Incidence and risk factors for human papillomavirus infections in young female online daters.‏
670 ‎‡a Author's INCIDENCE OF NON-GONOCOCCAL URETHRITIS (NGU) IN MEN WHO HAVE SEX WITH WOMEN (MSW) AND ASSOCIATED RISK FACTORS‏
670 ‎‡a Author's Incident Detection of High-Risk Human Papillomavirus Infections in a Cohort of High-Risk Women Aged 25-65 Years‏
670 ‎‡a Author's Increased Risk of Female HIV-1 Acquisition Throughout Pregnancy and Postpartum: A Prospective Per-coital Act Analysis Among Women with HIV-1 Infected Partners.‏
670 ‎‡a Author's Influence of study population on the identification of risk factors for sexually transmitted diseases using a case-control design: the example of gonorrhea.‏
670 ‎‡a Author's Initiation of antiretroviral therapy and viral suppression after home HIV testing and counselling in KwaZulu-Natal, South Africa, and Mbarara district, Uganda: a prospective, observational intervention study‏
670 ‎‡a Author's Integrated strategies for combination HIV prevention: principles and examples for men who have sex with men in the Americas and heterosexual African populations‏
670 ‎‡a Author's Lack of Association Between the S83I ParC Mutation in Mycoplasma genitalium and Treatment Outcomes Among Men Who Have Sex With Men with Nongonococcal Urethritis‏
670 ‎‡a Author's Lay health supporters aided by a mobile phone messaging system to improve care of villagers with schizophrenia in Liuyang, China: protocol for a randomised control trial‏
670 ‎‡a Author's Lay health supporters aided by mobile text messaging to improve adherence, symptoms, and functioning among people with schizophrenia in a resource-poor community in rural China (LEAN): A randomized controlled trial‏
670 ‎‡a Author's Lineages of oncogenic human papillomavirus types other than type 16 and 18 and risk for cervical intraepithelial neoplasia‏
670 ‎‡a Author's Longer term efficacy of a prophylactic monovalent human papillomavirus type 16 vaccine‏
670 ‎‡a Author's Low Disclosure of PrEP Nonadherence and HIV-Risk Behaviors Associated With Poor HIV PrEP Adherence in the HPTN 067/ADAPT Study‏
670 ‎‡a Author's Male circumcision and risk of HIV acquisition among MSM‏
670 ‎‡a Author's Male circumcision, religion, and infectious diseases: an ecologic analysis of 118 developing countries‏
670 ‎‡a Author's Measuring adherence to antipsychotic medications for schizophrenia: Concordance and validity among a community sample in rural China‏
670 ‎‡a Author's Methods for assessing the accuracy of PCR-based tests: comparisons and extensions‏
670 ‎‡a Author's Mobile Texting and Lay Health Supporters to Improve Schizophrenia Care in a Resource-Poor Community in Rural China (LEAN Trial): Randomized Controlled Trial Extended Implementation‏
670 ‎‡a Author's Modeling breastmilk infectivity in HIV-1 infected mothers‏
670 ‎‡a Author's Modeling HIV disease progression and transmission at population-level: The potential impact of modifying disease progression in HIV treatment programs‏
670 ‎‡a Author's Monitoring HIV Preexposure Prophylaxis Use Among Men Who Have Sex With Men in Washington State: Findings From an Internet-Based Survey‏
670 ‎‡a Author's Multilevel Measures of Education and Pathways to Incident Herpes Simplex Virus Type 2 in Adolescent Girls and Young Women in South Africa‏
670 ‎‡a Author's Mutation of HIV-1 genomes in a clinical population treated with the mutagenic nucleoside KP1461‏
670 ‎‡a Author's Mutations based on viral decay acceleration in the HIV-1 genomes of a clinical population treated with the mutagenic nucleoside KP1461.‏
670 ‎‡a Author's Mycoplasma genitalium among young adults in the United States: an emerging sexually transmitted infection‏
670 ‎‡a Author's Natural control of HIV infection in young women in South Africa: HPTN 068‏
670 ‎‡a Author's Non-monogamy and risk of infection with Chlamydia trachomatis and Trichomonas vaginalis among young adults and their cohabiting partners in Peru‏
670 ‎‡a Author's Oncogenic Human Papillomavirus Infections in 18- to 24-Year-Old Female Online Daters‏
670 ‎‡a Author's Operationalizing the Measurement of Seroadaptive Behaviors: A Comparison of Reported Sexual Behaviors and Purposely-Adopted Behaviors Among Men who have Sex with Men (MSM) in Seattle‏
670 ‎‡a Author's Optimizing the Timing of HIV Screening as Part of Routine Medical Care‏
670 ‎‡a Author's Participation in a clinical trial of a text messaging intervention is associated with increased infant HIV testing: A parallel-cohort randomized controlled trial‏
670 ‎‡a Author's Partner characteristics predicting HIV-1 set point in sexually acquired HIV-1 among African seroconverters‏
670 ‎‡a Author's Patient volume, human resource levels, and attrition from HIV treatment programs in central Mozambique‏
670 ‎‡a Author's Performance of a high-throughput next-generation sequencing method for analysis of HIV drug resistance and viral load‏
670 ‎‡a Author's Persistence of genital human papillomavirus infection in a long-term follow-up study of female university students.‏
670 ‎‡a Author's Plasma cytokine levels and risk of HIV type 1 (HIV-1) transmission and acquisition: a nested case-control study among HIV-1-serodiscordant couples‏
670 ‎‡a Author's Positive predictive value of Gen-Probe APTIMA Combo 2 testing for Neisseria gonorrhoeae in a population of women with low prevalence of N. gonorrhoeae infection‏
670 ‎‡a Author's Post-traumatic Stress Disorder Symptoms and Mental Health over Time among Low-Income Women at Increased Risk of HIV in the U.S.‏
670 ‎‡a Author's Predicted effectiveness of daily and non-daily PrEP for MSM based on sex and pill-taking patterns from HPTN 067/ADAPT‏
670 ‎‡a Author's Prediction of HIV acquisition among men who have sex with men.‏
670 ‎‡a Author's Pregnancy, contraceptive use, and HIV acquisition in HPTN 039: relevance for HIV prevention trials among African women‏
670 ‎‡a Author's Prevalence and Associations, by Age Group, of IPV Among AGYW in Rural South Africa‏
670 ‎‡a Author's Prevalence and correlates of intimate partner violence in HIV-positive women engaged in transactional sex in Mombasa, Kenya‏
670 ‎‡a Author's Prevalence and correlates of knowledge of male partner HIV testing and serostatus among African-American women living in high poverty, high HIV prevalence communities (HPTN 064).‏
670 ‎‡a Author's Prevalence and risk factors for oncogenic human papillomavirus infections in high-risk mid-adult women‏
670 ‎‡a Author's Prevalences of sexually transmitted infections in young adults and female sex workers in Peru: a national population-based survey‏
670 ‎‡a Author's Prevention of sexually transmitted infections in urban communities (Peru PREVEN): a multicomponent community-randomised controlled trial‏
670 ‎‡a Author's Prior human polyomavirus and papillomavirus infection and incident lung cancer: a nested case-control study‏
670 ‎‡a Author's Projected demographic composition of the United States population of people living with diagnosed HIV.‏
670 ‎‡a Author's Quality of HIV care provided by non-physician clinicians and physicians in Mozambique: a retrospective cohort study‏
670 ‎‡a Author's Quantitative human papillomavirus 16 and 18 levels in incident infections and cervical lesion development‏
670 ‎‡a Author's Randomised treatment trial of bacterial vaginosis to prevent post-abortion complication‏
670 ‎‡a Author's Rates and determinants of oral human papillomavirus infection in young men‏
670 ‎‡a Author's Re-detection vs. new acquisition of high-risk human papillomavirus in mid-adult women‏
670 ‎‡a Author's Reconciling the evaluation of co-morbidities among HIV care patients in two large data systems: the Medical Monitoring Project and CFAR Network of Integrated Clinical Systems‏
670 ‎‡a Author's Regression to the mean and changes in risk behavior following study enrollment in a cohort of U.S. women at risk for HIV.‏
670 ‎‡a Author's Relationship between community-level alcohol outlet accessibility and individual-level herpes simplex virus type 2 infection among young women in South Africa‏
670 ‎‡a Author's Residual Effect of Texting to Promote Medication Adherence for Villagers with Schizophrenia in China: 18-Month Follow-up Survey After the Randomized Controlled Trial Discontinuation‏
670 ‎‡a Author's Resolution of Symptoms and Resumption of Sex After Diagnosis of Nongonococcal Urethritis Among Men Who Have Sex With Men‏
670 ‎‡a Author's Results from e-KISS: electronic-KIOSK Intervention for Safer Sex: A pilot randomized controlled trial of an interactive computer-based intervention for sexual health in adolescents and young adults‏
670 ‎‡a Author's Results from eKISS (electronic KIOSK Intervention for Safer-Sex): A Pilot Randomized Controlled Trial to Test an Interactive Computer-Based Intervention for Sexual Health in Adolescents and Young Adults‏
670 ‎‡a Author's Retention strategies and factors associated with missed visits among low income women at increased risk of HIV acquisition in the US‏
670 ‎‡a Author's Retention strategies and factors associated with missed visits among low income women at increased risk of HIV acquisition in the US (HPTN 064).‏
670 ‎‡a Author's Risk of female human papillomavirus acquisition associated with first male sex partner‏
670 ‎‡a Author's Robust inference for the stepped wedge design‏
670 ‎‡a Author's Self-Esteem as an Indicator of Transactional Sex Among Young Women in Rural South Africa (HPTN 068)‏
670 ‎‡a Author's Sentinel surveillance of sexually transmitted infections/HIV and risk behaviors in vulnerable populations in 5 Central American countries.‏
670 ‎‡a Author's Sexual intercourse and risk of symptomatic urinary tract infection in post-menopausal women‏
670 ‎‡a Author's Sexual Partner Types and Incident HIV Infection Among Rural South African Adolescent Girls and Young Women Enrolled in HPTN 068: A Latent Class Analysis‏
670 ‎‡a Author's Sexual Partnership Patterns Among South African Adolescent Girls Enrolled in HPTN [corrected] 068: Measurement Challenges and Implications for HIV/STI Transmission‏
670 ‎‡a Author's Sexually transmitted infection screening uptake and knowledge of sexually transmitted infection symptoms among female sex workers participating in a community randomised trial in Peru‏
670 ‎‡a Author's Short- and Long-Term Pharmacologic Measures of HIV Pre-exposure Prophylaxis Use Among High-Risk Men Who Have Sex With Men in HPTN 067/ADAPT‏
670 ‎‡a Author's Short-term natural history of high-risk human papillomavirus infection in mid-adult women sampled monthly‏
670 ‎‡a Author's Simulations for designing and interpreting intervention trials in infectious diseases‏
670 ‎‡a Author's Standard treatment regimens for nongonococcal urethritis have similar but declining cure rates: a randomized controlled trial‏
670 ‎‡a Author's Statistical methods for determining the accuracy of quantitative polymerase chain reaction-based tests‏
670 ‎‡a Author's Study design considerations for evaluating efficacy of systemic preexposure prophylaxis interventions‏
670 ‎‡a Author's Studying complex interactions among determinants of healthcare-seeking behaviours: self-medication for sexually transmitted infection symptoms in female sex workers‏
670 ‎‡a Author's Substance use patterns and factors associated with changes over time in a cohort of heterosexual women at risk for HIV acquisition in the United States.‏
670 ‎‡a Author's Summary measures of adherence using pill counts in two HIV prevention trials: the need for standardisation in reporting‏
670 ‎‡a Author's Text messaging for maternal and infant retention in prevention of mother-to-child HIV transmission services: A pragmatic stepped-wedge cluster-randomized trial in Kenya‏
670 ‎‡a Author's The effect of a conditional cash transfer on HIV incidence in young women in rural South Africa (HPTN 068): a phase 3, randomised controlled trial.‏
670 ‎‡a Author's The Effect of Depression on Adherence to HIV Pre-exposure Prophylaxis Among High-Risk South African Women in HPTN 067/ADAPT‏
670 ‎‡a Author's The effect of school attendance and school dropout on incident HIV and HSV-2 among young women in rural South Africa enrolled in HPTN 068.‏
670 ‎‡a Author's The effect of schooling on age-disparate relationships and number of sexual partners among young women in rural South Africa enrolled in HPTN 068.‏
670 ‎‡a Author's The Mediating Role of Partner Selection in the Association Between Transactional Sex and HIV Incidence Among Young Women‏
670 ‎‡a Author's The potential impact of one-time routine HIV screening on prevention and clinical outcomes in the United States: a model-based analysis‏
670 ‎‡a Author's The Relationship between Alcohol Outlets, HIV Risk Behavior, and HSV-2 Infection among South African Young Women: A Cross-Sectional Study.‏
670 ‎‡a Author's The Relationship Between School Dropout and Pregnancy Among Adolescent Girls and Young Women in South Africa: A HPTN 068 Analysis‏
670 ‎‡a Author's The theoretical population-level impact of a prophylactic human papilloma virus vaccine‏
670 ‎‡a Author's The validity of self-reported behaviors: methods for estimating underreporting of risk behaviors‏
670 ‎‡a Author's Transactional sex among young women in rural South Africa: prevalence, mediators and association with HIV infection‏
670 ‎‡a Author's Transactional sex and incident HIV infection in a cohort of young women from rural South Africa enrolled in HPTN 068.‏
670 ‎‡a Author's Treatment as Prevention: Characterization of Partner Infections in the HIV Prevention Trials Network 052 Trial‏
670 ‎‡a Author's Trends in Serosorting and the Association With HIV/STI Risk Over Time Among Men Who Have Sex With Men.‏
670 ‎‡a Author's Type-dependent association between risk of cervical intraepithelial neoplasia and viral load of oncogenic human papillomavirus types other than types 16 and 18.‏
670 ‎‡a Author's Understanding the HIV epidemic among MSM in Baltimore: a modelling study estimating the impact of past HIV interventions and who acquired and contributed to infections‏
670 ‎‡a Author's Understanding the potential impact of a combination HIV prevention intervention in a hyper-endemic community.‏
670 ‎‡a Author's Uptake and impact of facility-based HIV self-testing on PrEP delivery: a pilot study among young women in Kisumu, Kenya‏
670 ‎‡a Author's Uptake and population-level impact of expedited partner therapy‏
670 ‎‡a Author's Uptake and population-level impact of expedited partner therapy (EPT) on Chlamydia trachomatis and Neisseria gonorrhoeae: the Washington State community-level randomized trial of EPT.‏
670 ‎‡a Author's Uptake of antiretroviral therapy and male circumcision after community-based HIV testing and strategies for linkage to care versus standard clinic referral: a multisite, open-label, randomised controlled trial in South Africa and Uganda‏
670 ‎‡a Author's Urethral microbiota in men: Association of Haemophilus influenzae and Mycoplasma penetrans with nongonococcal urethritis‏
670 ‎‡a Author's Use of a multifaceted approach to analyze HIV incidence in a cohort study of women in the United States: HIV Prevention Trials Network 064 Study‏
670 ‎‡a Author's Using nurses to identify HAART eligible patients in the Republic of Mozambique: results of a time series analysis‏
670 ‎‡a Author's Using plasma viral load to guide antiretroviral therapy initiation to prevent HIV-1 transmission‏
670 ‎‡a Author's Variant-specific persistence of infections with human papillomavirus Types 31, 33, 45, 56 and 58 and risk of cervical intraepithelial neoplasia‏
670 ‎‡a Author's Variations in HIV Risk by Young Women's Age and Partner Age Disparity in Rural South Africa (HPTN 068)‏
670 ‎‡a Author's Venue-based recruitment of women at elevated risk for HIV: an HIV Prevention Trials Network study‏
670 ‎‡a Author's Violence Against Women in Selected Areas of the United States.‏
670 ‎‡a Author's Viral linkage in HIV-1 seroconverters and their partners in an HIV-1 prevention clinical trial‏
670 ‎‡a Author's Viral load and short-term natural history of type-specific oncogenic human papillomavirus infections in a high-risk cohort of midadult women‏
670 ‎‡a Author's Viral load in the natural history of human papillomavirus type 16 infection: a nested case-control study‏
909 ‎‡a (orcid) 0000000150343157‏ ‎‡9 1‏
919 ‎‡a residualeffectoftextingtopromotemedicationadherenceforvillagerswithschizophreniainchina18monthfollowupsurveyaftertherandomizedcontrolledtrialdiscontinuation‏ ‎‡A Residual Effect of Texting to Promote Medication Adherence for Villagers with Schizophrenia in China: 18-Month Follow-up Survey After the Randomized Controlled Trial Discontinuation‏ ‎‡9 1‏
919 ‎‡a viralloadinthenaturalhistoryofhumanpapillomavirustype16infectionanestedcasecontrolstudy‏ ‎‡A Viral load in the natural history of human papillomavirus type 16 infection: a nested case-control study‏ ‎‡9 1‏
919 ‎‡a viralloadandshorttermnaturalhistoryoftypespecificoncogenichumanpapillomavirusinfectionsinahighriskcohortofmidadultwomen‏ ‎‡A Viral load and short-term natural history of type-specific oncogenic human papillomavirus infections in a high-risk cohort of midadult women‏ ‎‡9 1‏
919 ‎‡a virallinkageinhiv1seroconvertersandtheirpartnersinanhiv1preventionclinicaltrial‏ ‎‡A Viral linkage in HIV-1 seroconverters and their partners in an HIV-1 prevention clinical trial‏ ‎‡9 1‏
919 ‎‡a violenceagainstwomeninselectedareasoftheunitedstates‏ ‎‡A Violence Against Women in Selected Areas of the United States.‏ ‎‡9 1‏
919 ‎‡a venuebasedrecruitmentofwomenatelevatedriskforhivanhivpreventiontrialsnetworkstudy‏ ‎‡A Venue-based recruitment of women at elevated risk for HIV: an HIV Prevention Trials Network study‏ ‎‡9 1‏
919 ‎‡a variationsinhivriskbyyoungwomensageandpartneragedisparityinruralsouthafricahptn068‏ ‎‡A Variations in HIV Risk by Young Women's Age and Partner Age Disparity in Rural South Africa (HPTN 068)‏ ‎‡9 1‏
919 ‎‡a variantspecificpersistenceofinfectionswithhumanpapillomavirustypes31334556and58andriskofcervicalintraepithelialneoplasia‏ ‎‡A Variant-specific persistence of infections with human papillomavirus Types 31, 33, 45, 56 and 58 and risk of cervical intraepithelial neoplasia‏ ‎‡9 1‏
919 ‎‡a usingplasmaviralloadtoguideantiretroviraltherapyinitiationtopreventhiv1transmission‏ ‎‡A Using plasma viral load to guide antiretroviral therapy initiation to prevent HIV-1 transmission‏ ‎‡9 1‏
919 ‎‡a usingnursestoidentifyhaarteligiblepatientsintherepublicofmozambiqueresultsofatimeseriesanalysis‏ ‎‡A Using nurses to identify HAART eligible patients in the Republic of Mozambique: results of a time series analysis‏ ‎‡9 1‏
919 ‎‡a useofamultifacetedapproachtoanalyzehivincidenceinacohortstudyofwomenintheunitedstateshivpreventiontrialsnetwork064study‏ ‎‡A Use of a multifaceted approach to analyze HIV incidence in a cohort study of women in the United States: HIV Prevention Trials Network 064 Study‏ ‎‡9 1‏
919 ‎‡a urethralmicrobiotainmenassociationofhaemophilusinfluenzaeandmycoplasmapenetranswithnongonococcalurethritis‏ ‎‡A Urethral microbiota in men: Association of Haemophilus influenzae and Mycoplasma penetrans with nongonococcal urethritis‏ ‎‡9 1‏
919 ‎‡a uptakeofantiretroviraltherapyandmalecircumcisionaftercommunitybasedhivtestingandstrategiesforlinkagetocareversusstandardclinicreferralamultisiteopenlabelrandomisedcontrolledtrialinsouthafricaanduganda‏ ‎‡A Uptake of antiretroviral therapy and male circumcision after community-based HIV testing and strategies for linkage to care versus standard clinic referral: a multisite, open-label, randomised controlled trial in South Africa and Uganda‏ ‎‡9 1‏
919 ‎‡a uptakeandpopulationlevelimpactofexpeditedpartnertherapyeptonchlamydiatrachomatisandneisseriagonorrhoeaethewashingtonstatecommunitylevelrandomizedtrialofept‏ ‎‡A Uptake and population-level impact of expedited partner therapy (EPT) on Chlamydia trachomatis and Neisseria gonorrhoeae: the Washington State community-level randomized trial of EPT.‏ ‎‡9 1‏
919 ‎‡a uptakeandpopulationlevelimpactofexpeditedpartnertherapy‏ ‎‡A Uptake and population-level impact of expedited partner therapy‏ ‎‡9 1‏
919 ‎‡a uptakeandimpactoffacilitybasedhivselftestingonprepdeliveryapilotstudyamongyoungwomeninkisumukenya‏ ‎‡A Uptake and impact of facility-based HIV self-testing on PrEP delivery: a pilot study among young women in Kisumu, Kenya‏ ‎‡9 1‏
919 ‎‡a understandingthepotentialimpactofacombinationhivpreventioninterventioninahyperendemiccommunity‏ ‎‡A Understanding the potential impact of a combination HIV prevention intervention in a hyper-endemic community.‏ ‎‡9 1‏
919 ‎‡a understandingthehivepidemicamongmsminbaltimoreamodellingstudyestimatingtheimpactofpasthivinterventionsandwhoacquiredandcontributedtoinfections‏ ‎‡A Understanding the HIV epidemic among MSM in Baltimore: a modelling study estimating the impact of past HIV interventions and who acquired and contributed to infections‏ ‎‡9 1‏
919 ‎‡a typedependentassociationbetweenriskofcervicalintraepithelialneoplasiaandviralloadofoncogenichumanpapillomavirustypesotherthantypes16and18‏ ‎‡A Type-dependent association between risk of cervical intraepithelial neoplasia and viral load of oncogenic human papillomavirus types other than types 16 and 18.‏ ‎‡9 1‏
919 ‎‡a trendsinserosortingandtheassociationwithhivstiriskovertimeamongmenwhohavesexwithmen‏ ‎‡A Trends in Serosorting and the Association With HIV/STI Risk Over Time Among Men Who Have Sex With Men.‏ ‎‡9 1‏
919 ‎‡a treatmentaspreventioncharacterizationofpartnerinfectionsinthehivpreventiontrialsnetwork052trial‏ ‎‡A Treatment as Prevention: Characterization of Partner Infections in the HIV Prevention Trials Network 052 Trial‏ ‎‡9 1‏
919 ‎‡a transactionalsexandincidenthivinfectioninacohortofyoungwomenfromruralsouthafricaenrolledinhptn068‏ ‎‡A Transactional sex and incident HIV infection in a cohort of young women from rural South Africa enrolled in HPTN 068.‏ ‎‡9 1‏
919 ‎‡a transactionalsexamongyoungwomeninruralsouthafricaprevalencemediatorsandassociationwithhivinfection‏ ‎‡A Transactional sex among young women in rural South Africa: prevalence, mediators and association with HIV infection‏ ‎‡9 1‏
919 ‎‡a validityofselfreportedbehaviorsmethodsforestimatingunderreportingofriskbehaviors‏ ‎‡A The validity of self-reported behaviors: methods for estimating underreporting of risk behaviors‏ ‎‡9 1‏
919 ‎‡a theoreticalpopulationlevelimpactofaprophylactichumanpapillomavirusvaccine‏ ‎‡A The theoretical population-level impact of a prophylactic human papilloma virus vaccine‏ ‎‡9 1‏
919 ‎‡a relationshipbetweenschooldropoutandpregnancyamongadolescentgirlsandyoungwomeninsouthafricaahptn068analysis‏ ‎‡A The Relationship Between School Dropout and Pregnancy Among Adolescent Girls and Young Women in South Africa: A HPTN 068 Analysis‏ ‎‡9 1‏
919 ‎‡a relationshipbetweenalcoholoutletshivriskbehaviorandhsv2infectionamongsouthafricanyoungwomenacrosssectionalstudy‏ ‎‡A The Relationship between Alcohol Outlets, HIV Risk Behavior, and HSV-2 Infection among South African Young Women: A Cross-Sectional Study.‏ ‎‡9 1‏
919 ‎‡a potentialimpactof1timeroutinehivscreeningonpreventionandclinicaloutcomesintheunitedstatesamodelbasedanalysis‏ ‎‡A The potential impact of one-time routine HIV screening on prevention and clinical outcomes in the United States: a model-based analysis‏ ‎‡9 1‏
919 ‎‡a mediatingroleofpartnerselectionintheassociationbetweentransactionalsexandhivincidenceamongyoungwomen‏ ‎‡A The Mediating Role of Partner Selection in the Association Between Transactional Sex and HIV Incidence Among Young Women‏ ‎‡9 1‏
919 ‎‡a effectofschoolingonagedisparaterelationshipsandnumberofsexualpartnersamongyoungwomeninruralsouthafricaenrolledinhptn068‏ ‎‡A The effect of schooling on age-disparate relationships and number of sexual partners among young women in rural South Africa enrolled in HPTN 068.‏ ‎‡9 1‏
919 ‎‡a effectofschoolattendanceandschooldropoutonincidenthivandhsv2amongyoungwomeninruralsouthafricaenrolledinhptn068‏ ‎‡A The effect of school attendance and school dropout on incident HIV and HSV-2 among young women in rural South Africa enrolled in HPTN 068.‏ ‎‡9 1‏
919 ‎‡a effectofdepressiononadherencetohivpreexposureprophylaxisamonghighrisksouthafricanwomeninhptn067adapt‏ ‎‡A The Effect of Depression on Adherence to HIV Pre-exposure Prophylaxis Among High-Risk South African Women in HPTN 067/ADAPT‏ ‎‡9 1‏
919 ‎‡a effectofaconditionalcashtransferonhivincidenceinyoungwomeninruralsouthafricahptn068aphase3randomisedcontrolledtrial‏ ‎‡A The effect of a conditional cash transfer on HIV incidence in young women in rural South Africa (HPTN 068): a phase 3, randomised controlled trial.‏ ‎‡9 1‏
919 ‎‡a textmessagingformaternalandinfantretentioninpreventionofmothertochildhivtransmissionservicesapragmaticsteppedwedgeclusterrandomizedtrialinkenya‏ ‎‡A Text messaging for maternal and infant retention in prevention of mother-to-child HIV transmission services: A pragmatic stepped-wedge cluster-randomized trial in Kenya‏ ‎‡9 1‏
919 ‎‡a summarymeasuresofadherenceusingpillcountsin2hivpreventiontrialstheneedforstandardisationinreporting‏ ‎‡A Summary measures of adherence using pill counts in two HIV prevention trials: the need for standardisation in reporting‏ ‎‡9 1‏
919 ‎‡a substanceusepatternsandfactorsassociatedwithchangesovertimeinacohortofheterosexualwomenatriskforhivacquisitionintheunitedstates‏ ‎‡A Substance use patterns and factors associated with changes over time in a cohort of heterosexual women at risk for HIV acquisition in the United States.‏ ‎‡9 1‏
919 ‎‡a studyingcomplexinteractionsamongdeterminantsofhealthcareseekingbehavioursselfmedicationforsexuallytransmittedinfectionsymptomsinfemalesexworkers‏ ‎‡A Studying complex interactions among determinants of healthcare-seeking behaviours: self-medication for sexually transmitted infection symptoms in female sex workers‏ ‎‡9 1‏
919 ‎‡a studydesignconsiderationsforevaluatingefficacyofsystemicpreexposureprophylaxisinterventions‏ ‎‡A Study design considerations for evaluating efficacy of systemic preexposure prophylaxis interventions‏ ‎‡9 1‏
919 ‎‡a statisticalmethodsfordeterminingtheaccuracyofquantitativepolymerasechainreactionbasedtests‏ ‎‡A Statistical methods for determining the accuracy of quantitative polymerase chain reaction-based tests‏ ‎‡9 1‏
919 ‎‡a standardtreatmentregimensfornongonococcalurethritishavesimilarbutdecliningcureratesarandomizedcontrolledtrial‏ ‎‡A Standard treatment regimens for nongonococcal urethritis have similar but declining cure rates: a randomized controlled trial‏ ‎‡9 1‏
919 ‎‡a simulationsfordesigningandinterpretinginterventiontrialsininfectiousdiseases‏ ‎‡A Simulations for designing and interpreting intervention trials in infectious diseases‏ ‎‡9 1‏
919 ‎‡a shorttermnaturalhistoryofhighriskhumanpapillomavirusinfectioninmidadultwomensampledmonthly‏ ‎‡A Short-term natural history of high-risk human papillomavirus infection in mid-adult women sampled monthly‏ ‎‡9 1‏
919 ‎‡a shortandlongtermpharmacologicmeasuresofhivpreexposureprophylaxisuseamonghighriskmenwhohavesexwithmeninhptn067adapt‏ ‎‡A Short- and Long-Term Pharmacologic Measures of HIV Pre-exposure Prophylaxis Use Among High-Risk Men Who Have Sex With Men in HPTN 067/ADAPT‏ ‎‡9 1‏
919 ‎‡a sexuallytransmittedinfectionscreeninguptakeandknowledgeofsexuallytransmittedinfectionsymptomsamongfemalesexworkersparticipatinginacommunityrandomisedtrialinperu‏ ‎‡A Sexually transmitted infection screening uptake and knowledge of sexually transmitted infection symptoms among female sex workers participating in a community randomised trial in Peru‏ ‎‡9 1‏
919 ‎‡a sexualpartnershippatternsamongsouthafricanadolescentgirlsenrolledinhptn068measurementchallengesandimplicationsforhivstitransmission‏ ‎‡A Sexual Partnership Patterns Among South African Adolescent Girls Enrolled in HPTN [corrected] 068: Measurement Challenges and Implications for HIV/STI Transmission‏ ‎‡9 1‏
919 ‎‡a sexualpartnertypesandincidenthivinfectionamongruralsouthafricanadolescentgirlsandyoungwomenenrolledinhptn068alatentclassanalysis‏ ‎‡A Sexual Partner Types and Incident HIV Infection Among Rural South African Adolescent Girls and Young Women Enrolled in HPTN 068: A Latent Class Analysis‏ ‎‡9 1‏
919 ‎‡a sexualintercourseandriskofsymptomaticurinarytractinfectioninpostmenopausalwomen‏ ‎‡A Sexual intercourse and risk of symptomatic urinary tract infection in post-menopausal women‏ ‎‡9 1‏
919 ‎‡a sentinelsurveillanceofsexuallytransmittedinfectionshivandriskbehaviorsinvulnerablepopulationsin5centralamericancountries‏ ‎‡A Sentinel surveillance of sexually transmitted infections/HIV and risk behaviors in vulnerable populations in 5 Central American countries.‏ ‎‡9 1‏
919 ‎‡a selfesteemasanindicatoroftransactionalsexamongyoungwomeninruralsouthafricahptn068‏ ‎‡A Self-Esteem as an Indicator of Transactional Sex Among Young Women in Rural South Africa (HPTN 068)‏ ‎‡9 1‏
919 ‎‡a robustinferenceforthesteppedwedgedesign‏ ‎‡A Robust inference for the stepped wedge design‏ ‎‡9 1‏
919 ‎‡a riskoffemalehumanpapillomavirusacquisitionassociatedwith1malesexpartner‏ ‎‡A Risk of female human papillomavirus acquisition associated with first male sex partner‏ ‎‡9 1‏
919 ‎‡a retentionstrategiesandfactorsassociatedwithmissedvisitsamonglowincomewomenatincreasedriskofhivacquisitionintheushptn064‏ ‎‡A Retention strategies and factors associated with missed visits among low income women at increased risk of HIV acquisition in the US (HPTN 064).‏ ‎‡9 1‏
919 ‎‡a retentionstrategiesandfactorsassociatedwithmissedvisitsamonglowincomewomenatincreasedriskofhivacquisitionintheus‏ ‎‡A Retention strategies and factors associated with missed visits among low income women at increased risk of HIV acquisition in the US‏ ‎‡9 1‏
919 ‎‡a resultsfromekisselectronickioskinterventionforsafersexapilotrandomizedcontrolledtrialtotestaninteractivecomputerbasedinterventionforsexualhealthinadolescentsandyoungadults‏ ‎‡A Results from eKISS (electronic KIOSK Intervention for Safer-Sex): A Pilot Randomized Controlled Trial to Test an Interactive Computer-Based Intervention for Sexual Health in Adolescents and Young Adults‏ ‎‡9 1‏
919 ‎‡a resultsfromekisselectronickioskinterventionforsafersexapilotrandomizedcontrolledtrialofaninteractivecomputerbasedinterventionforsexualhealthinadolescentsandyoungadults‏ ‎‡A Results from e-KISS: electronic-KIOSK Intervention for Safer Sex: A pilot randomized controlled trial of an interactive computer-based intervention for sexual health in adolescents and young adults‏ ‎‡9 1‏
919 ‎‡a resolutionofsymptomsandresumptionofsexafterdiagnosisofnongonococcalurethritisamongmenwhohavesexwithmen‏ ‎‡A Resolution of Symptoms and Resumption of Sex After Diagnosis of Nongonococcal Urethritis Among Men Who Have Sex With Men‏ ‎‡9 1‏
919 ‎‡a relationshipbetweencommunitylevelalcoholoutletaccessibilityandindividuallevelherpessimplexvirustype2infectionamongyoungwomeninsouthafrica‏ ‎‡A Relationship between community-level alcohol outlet accessibility and individual-level herpes simplex virus type 2 infection among young women in South Africa‏ ‎‡9 1‏
919 ‎‡a regressiontothemeanandchangesinriskbehaviorfollowingstudyenrollmentinacohortofuswomenatriskforhiv‏ ‎‡A Regression to the mean and changes in risk behavior following study enrollment in a cohort of U.S. women at risk for HIV.‏ ‎‡9 1‏
919 ‎‡a reconcilingtheevaluationofcomorbiditiesamonghivcarepatientsin2largedatasystemsthemedicalmonitoringprojectandcfarnetworkofintegratedclinicalsystems‏ ‎‡A Reconciling the evaluation of co-morbidities among HIV care patients in two large data systems: the Medical Monitoring Project and CFAR Network of Integrated Clinical Systems‏ ‎‡9 1‏
919 ‎‡a redetectionvsnewacquisitionofhighriskhumanpapillomavirusinmidadultwomen‏ ‎‡A Re-detection vs. new acquisition of high-risk human papillomavirus in mid-adult women‏ ‎‡9 1‏
919 ‎‡a ratesanddeterminantsoforalhumanpapillomavirusinfectioninyoungmen‏ ‎‡A Rates and determinants of oral human papillomavirus infection in young men‏ ‎‡9 1‏
919 ‎‡a randomisedtreatmenttrialofbacterialvaginosistopreventpostabortioncomplication‏ ‎‡A Randomised treatment trial of bacterial vaginosis to prevent post-abortion complication‏ ‎‡9 1‏
919 ‎‡a quantitativehumanpapillomavirus16and18levelsinincidentinfectionsandcervicallesiondevelopment‏ ‎‡A Quantitative human papillomavirus 16 and 18 levels in incident infections and cervical lesion development‏ ‎‡9 1‏
919 ‎‡a qualityofhivcareprovidedbynonphysiciancliniciansandphysiciansinmozambiquearetrospectivecohortstudy‏ ‎‡A Quality of HIV care provided by non-physician clinicians and physicians in Mozambique: a retrospective cohort study‏ ‎‡9 1‏
919 ‎‡a projecteddemographiccompositionoftheunitedstatespopulationofpeoplelivingwithdiagnosedhiv‏ ‎‡A Projected demographic composition of the United States population of people living with diagnosed HIV.‏ ‎‡9 1‏
919 ‎‡a priorhumanpolyomavirusandpapillomavirusinfectionandincidentlungcanceranestedcasecontrolstudy‏ ‎‡A Prior human polyomavirus and papillomavirus infection and incident lung cancer: a nested case-control study‏ ‎‡9 1‏
919 ‎‡a preventionofsexuallytransmittedinfectionsinurbancommunitiesperuprevenamulticomponentcommunityrandomisedcontrolledtrial‏ ‎‡A Prevention of sexually transmitted infections in urban communities (Peru PREVEN): a multicomponent community-randomised controlled trial‏ ‎‡9 1‏
919 ‎‡a prevalencesofsexuallytransmittedinfectionsinyoungadultsandfemalesexworkersinperuanationalpopulationbasedsurvey‏ ‎‡A Prevalences of sexually transmitted infections in young adults and female sex workers in Peru: a national population-based survey‏ ‎‡9 1‏
919 ‎‡a prevalenceandriskfactorsforoncogenichumanpapillomavirusinfectionsinhighriskmidadultwomen‏ ‎‡A Prevalence and risk factors for oncogenic human papillomavirus infections in high-risk mid-adult women‏ ‎‡9 1‏
919 ‎‡a prevalenceandcorrelatesofknowledgeofmalepartnerhivtestingandserostatusamongafricanamericanwomenlivinginhighpovertyhighhivprevalencecommunitieshptn064‏ ‎‡A Prevalence and correlates of knowledge of male partner HIV testing and serostatus among African-American women living in high poverty, high HIV prevalence communities (HPTN 064).‏ ‎‡9 1‏
919 ‎‡a prevalenceandcorrelatesofintimatepartnerviolenceinhivpositivewomenengagedintransactionalsexinmombasakenya‏ ‎‡A Prevalence and correlates of intimate partner violence in HIV-positive women engaged in transactional sex in Mombasa, Kenya‏ ‎‡9 1‏
919 ‎‡a prevalenceandassociationsbyagegroupofipvamongagywinruralsouthafrica‏ ‎‡A Prevalence and Associations, by Age Group, of IPV Among AGYW in Rural South Africa‏ ‎‡9 1‏
919 ‎‡a pregnancycontraceptiveuseandhivacquisitioninhptn039relevanceforhivpreventiontrialsamongafricanwomen‏ ‎‡A Pregnancy, contraceptive use, and HIV acquisition in HPTN 039: relevance for HIV prevention trials among African women‏ ‎‡9 1‏
919 ‎‡a predictionofhivacquisitionamongmenwhohavesexwithmen‏ ‎‡A Prediction of HIV acquisition among men who have sex with men.‏ ‎‡9 1‏
919 ‎‡a predictedeffectivenessofdailyandnondailyprepformsmbasedonsexandpilltakingpatternsfromhptn067adapt‏ ‎‡A Predicted effectiveness of daily and non-daily PrEP for MSM based on sex and pill-taking patterns from HPTN 067/ADAPT‏ ‎‡9 1‏
919 ‎‡a posttraumaticstressdisordersymptomsandmentalhealthovertimeamonglowincomewomenatincreasedriskofhivintheus‏ ‎‡A Post-traumatic Stress Disorder Symptoms and Mental Health over Time among Low-Income Women at Increased Risk of HIV in the U.S.‏ ‎‡9 1‏
919 ‎‡a positivepredictivevalueofgenprobeaptimacombo2testingforneisseriagonorrhoeaeinapopulationofwomenwithlowprevalenceofngonorrhoeaeinfection‏ ‎‡A Positive predictive value of Gen-Probe APTIMA Combo 2 testing for Neisseria gonorrhoeae in a population of women with low prevalence of N. gonorrhoeae infection‏ ‎‡9 1‏
919 ‎‡a plasmacytokinelevelsandriskofhivtype1hiv1transmissionandacquisitionanestedcasecontrolstudyamonghiv1serodiscordantcouples‏ ‎‡A Plasma cytokine levels and risk of HIV type 1 (HIV-1) transmission and acquisition: a nested case-control study among HIV-1-serodiscordant couples‏ ‎‡9 1‏
919 ‎‡a persistenceofgenitalhumanpapillomavirusinfectioninalongtermfollowupstudyoffemaleuniversitystudents‏ ‎‡A Persistence of genital human papillomavirus infection in a long-term follow-up study of female university students.‏ ‎‡9 1‏
919 ‎‡a performanceofahighthroughputnextgenerationsequencingmethodforanalysisofhivdrugresistanceandviralload‏ ‎‡A Performance of a high-throughput next-generation sequencing method for analysis of HIV drug resistance and viral load‏ ‎‡9 1‏
919 ‎‡a patientvolumehumanresourcelevelsandattritionfromhivtreatmentprogramsincentralmozambique‏ ‎‡A Patient volume, human resource levels, and attrition from HIV treatment programs in central Mozambique‏ ‎‡9 1‏
919 ‎‡a partnercharacteristicspredictinghiv1setpointinsexuallyacquiredhiv1amongafricanseroconverters‏ ‎‡A Partner characteristics predicting HIV-1 set point in sexually acquired HIV-1 among African seroconverters‏ ‎‡9 1‏
919 ‎‡a participationinaclinicaltrialofatextmessaginginterventionisassociatedwithincreasedinfanthivtestingaparallelcohortrandomizedcontrolledtrial‏ ‎‡A Participation in a clinical trial of a text messaging intervention is associated with increased infant HIV testing: A parallel-cohort randomized controlled trial‏ ‎‡9 1‏
919 ‎‡a optimizingthetimingofhivscreeningaspartofroutinemedicalcare‏ ‎‡A Optimizing the Timing of HIV Screening as Part of Routine Medical Care‏ ‎‡9 1‏
919 ‎‡a operationalizingthemeasurementofseroadaptivebehaviorsacomparisonofreportedsexualbehaviorsandpurposelyadoptedbehaviorsamongmenwhohavesexwithmenmsminseattle‏ ‎‡A Operationalizing the Measurement of Seroadaptive Behaviors: A Comparison of Reported Sexual Behaviors and Purposely-Adopted Behaviors Among Men who have Sex with Men (MSM) in Seattle‏ ‎‡9 1‏
919 ‎‡a oncogenichumanpapillomavirusinfectionsin18to24yearoldfemaleonlinedaters‏ ‎‡A Oncogenic Human Papillomavirus Infections in 18- to 24-Year-Old Female Online Daters‏ ‎‡9 1‏
919 ‎‡a nonmonogamyandriskofinfectionwithchlamydiatrachomatisandtrichomonasvaginalisamongyoungadultsandtheircohabitingpartnersinperu‏ ‎‡A Non-monogamy and risk of infection with Chlamydia trachomatis and Trichomonas vaginalis among young adults and their cohabiting partners in Peru‏ ‎‡9 1‏
919 ‎‡a naturalcontrolofhivinfectioninyoungwomeninsouthafricahptn068‏ ‎‡A Natural control of HIV infection in young women in South Africa: HPTN 068‏ ‎‡9 1‏
919 ‎‡a mycoplasmagenitaliumamongyoungadultsintheunitedstatesanemergingsexuallytransmittedinfection‏ ‎‡A Mycoplasma genitalium among young adults in the United States: an emerging sexually transmitted infection‏ ‎‡9 1‏
919 ‎‡a mutationsbasedonviraldecayaccelerationinthehiv1genomesofaclinicalpopulationtreatedwiththemutagenicnucleosidek‏ ‎‡A Mutations based on viral decay acceleration in the HIV-1 genomes of a clinical population treated with the mutagenic nucleoside KP1461.‏ ‎‡9 1‏
919 ‎‡a mutationofhiv1genomesinaclinicalpopulationtreatedwiththemutagenicnucleosidek‏ ‎‡A Mutation of HIV-1 genomes in a clinical population treated with the mutagenic nucleoside KP1461‏ ‎‡9 1‏
919 ‎‡a multilevelmeasuresofeducationandpathwaystoincidentherpessimplexvirustype2inadolescentgirlsandyoungwomeninsouthafrica‏ ‎‡A Multilevel Measures of Education and Pathways to Incident Herpes Simplex Virus Type 2 in Adolescent Girls and Young Women in South Africa‏ ‎‡9 1‏
919 ‎‡a monitoringhivpreexposureprophylaxisuseamongmenwhohavesexwithmeninwashingtonstatefindingsfromaninternetbasedsurvey‏ ‎‡A Monitoring HIV Preexposure Prophylaxis Use Among Men Who Have Sex With Men in Washington State: Findings From an Internet-Based Survey‏ ‎‡9 1‏
919 ‎‡a modelinghivdiseaseprogressionandtransmissionatpopulationlevelthepotentialimpactofmodifyingdiseaseprogressioninhivtreatmentprograms‏ ‎‡A Modeling HIV disease progression and transmission at population-level: The potential impact of modifying disease progression in HIV treatment programs‏ ‎‡9 1‏
919 ‎‡a modelingbreastmilkinfectivityinhiv1infectedmothers‏ ‎‡A Modeling breastmilk infectivity in HIV-1 infected mothers‏ ‎‡9 1‏
919 ‎‡a mobiletextingandlayhealthsupporterstoimproveschizophreniacareinaresourcepoorcommunityinruralchinaleantrialrandomizedcontrolledtrialextendedimplementation‏ ‎‡A Mobile Texting and Lay Health Supporters to Improve Schizophrenia Care in a Resource-Poor Community in Rural China (LEAN Trial): Randomized Controlled Trial Extended Implementation‏ ‎‡9 1‏
919 ‎‡a methodsforassessingtheaccuracyofpcrbasedtestscomparisonsandextensions‏ ‎‡A Methods for assessing the accuracy of PCR-based tests: comparisons and extensions‏ ‎‡9 1‏
919 ‎‡a measuringadherencetoantipsychoticmedicationsforschizophreniaconcordanceandvalidityamongacommunitysampleinruralchina‏ ‎‡A Measuring adherence to antipsychotic medications for schizophrenia: Concordance and validity among a community sample in rural China‏ ‎‡9 1‏
919 ‎‡a malecircumcisionreligionandinfectiousdiseasesanecologicanalysisof118developingcountries‏ ‎‡A Male circumcision, religion, and infectious diseases: an ecologic analysis of 118 developing countries‏ ‎‡9 1‏
919 ‎‡a malecircumcisionandriskofhivacquisitionamongmsm‏ ‎‡A Male circumcision and risk of HIV acquisition among MSM‏ ‎‡9 1‏
919 ‎‡a lowdisclosureofprepnonadherenceandhivriskbehaviorsassociatedwithpoorhivprepadherenceinthehptn067adaptstudy‏ ‎‡A Low Disclosure of PrEP Nonadherence and HIV-Risk Behaviors Associated With Poor HIV PrEP Adherence in the HPTN 067/ADAPT Study‏ ‎‡9 1‏
919 ‎‡a longertermefficacyofaprophylacticmonovalenthumanpapillomavirustype16vaccine‏ ‎‡A Longer term efficacy of a prophylactic monovalent human papillomavirus type 16 vaccine‏ ‎‡9 1‏
919 ‎‡a lineagesofoncogenichumanpapillomavirustypesotherthantype16and18andriskforcervicalintraepithelialneoplasia‏ ‎‡A Lineages of oncogenic human papillomavirus types other than type 16 and 18 and risk for cervical intraepithelial neoplasia‏ ‎‡9 1‏
919 ‎‡a layhealthsupportersaidedbymobiletextmessagingtoimproveadherencesymptomsandfunctioningamongpeoplewithschizophreniainaresourcepoorcommunityinruralchinaleanarandomizedcontrolledtrial‏ ‎‡A Lay health supporters aided by mobile text messaging to improve adherence, symptoms, and functioning among people with schizophrenia in a resource-poor community in rural China (LEAN): A randomized controlled trial‏ ‎‡9 1‏
919 ‎‡a layhealthsupportersaidedbyamobilephonemessagingsystemtoimprovecareofvillagerswithschizophreniainliuyangchinaprotocolforarandomisedcontroltrial‏ ‎‡A Lay health supporters aided by a mobile phone messaging system to improve care of villagers with schizophrenia in Liuyang, China: protocol for a randomised control trial‏ ‎‡9 1‏
919 ‎‡a lackofassociationbetweenthes83iparcmutationinmycoplasmagenitaliumandtreatmentoutcomesamongmenwhohavesexwithmenwithnongonococcalurethritis‏ ‎‡A Lack of Association Between the S83I ParC Mutation in Mycoplasma genitalium and Treatment Outcomes Among Men Who Have Sex With Men with Nongonococcal Urethritis‏ ‎‡9 1‏
919 ‎‡a integratedstrategiesforcombinationhivpreventionprinciplesandexamplesformenwhohavesexwithmenintheamericasandheterosexualafricanpopulations‏ ‎‡A Integrated strategies for combination HIV prevention: principles and examples for men who have sex with men in the Americas and heterosexual African populations‏ ‎‡9 1‏
919 ‎‡a initiationofantiretroviraltherapyandviralsuppressionafterhomehivtestingandcounsellinginkwazulunatalsouthafricaandmbararadistrictugandaaprospectiveobservationalinterventionstudy‏ ‎‡A Initiation of antiretroviral therapy and viral suppression after home HIV testing and counselling in KwaZulu-Natal, South Africa, and Mbarara district, Uganda: a prospective, observational intervention study‏ ‎‡9 1‏
919 ‎‡a influenceofstudypopulationontheidentificationofriskfactorsforsexuallytransmitteddiseasesusingacasecontroldesigntheexampleofgonorrhea‏ ‎‡A Influence of study population on the identification of risk factors for sexually transmitted diseases using a case-control design: the example of gonorrhea.‏ ‎‡9 1‏
919 ‎‡a increasedriskoffemalehiv1acquisitionthroughoutpregnancyandpostpartumaprospectivepercoitalactanalysisamongwomenwithhiv1infectedpartners‏ ‎‡A Increased Risk of Female HIV-1 Acquisition Throughout Pregnancy and Postpartum: A Prospective Per-coital Act Analysis Among Women with HIV-1 Infected Partners.‏ ‎‡9 1‏
919 ‎‡a incidentdetectionofhighriskhumanpapillomavirusinfectionsinacohortofhighriskwomenaged2565years‏ ‎‡A Incident Detection of High-Risk Human Papillomavirus Infections in a Cohort of High-Risk Women Aged 25-65 Years‏ ‎‡9 1‏
919 ‎‡a incidenceofnongonococcalurethritisnguinmenwhohavesexwithwomenmswandassociatedriskfactors‏ ‎‡A INCIDENCE OF NON-GONOCOCCAL URETHRITIS (NGU) IN MEN WHO HAVE SEX WITH WOMEN (MSW) AND ASSOCIATED RISK FACTORS‏ ‎‡9 1‏
919 ‎‡a incidenceandriskfactorsforhumanpapillomavirusinfectionsinyoungfemaleonlinedaters‏ ‎‡A Incidence and risk factors for human papillomavirus infections in young female online daters.‏ ‎‡9 1‏
919 ‎‡a inwhatcircumstancescouldnondailypreexposureprophylaxisforhivsubstantiallyreduceprogramcosts‏ ‎‡A In what circumstances could nondaily preexposure prophylaxis for HIV substantially reduce program costs?‏ ‎‡9 1‏
919 ‎‡a improvementsinthehivcarecontinuumneededtomeaningfullyreducehivincidenceamongmenwhohavesexwithmeninbaltimoreusamodellingstudyforhptn078‏ ‎‡A Improvements in the HIV care continuum needed to meaningfully reduce HIV incidence among men who have sex with men in Baltimore, US: a modelling study for HPTN 078‏ ‎‡9 1‏
919 ‎‡a implementationandoperationalresearchactivereferralofchildrenofhivpositiveadultsrevealshighprevalenceofundiagnosedhiv‏ ‎‡A Implementation and Operational Research: Active Referral of Children of HIV-Positive Adults Reveals High Prevalence of Undiagnosed HIV.‏ ‎‡9 1‏
919 ‎‡a humanpapillomavirustype16viralloadinrelationtohivinfectioncervicalneoplasiaandcancerinsenegal‏ ‎‡A Human papillomavirus type 16 viral load in relation to HIV infection, cervical neoplasia and cancer in Senegal.‏ ‎‡9 1‏
919 ‎‡a humanpapillomavirushpvtype16andtype18dnaloadsatbaselineandpersistenceoftypespecificinfectionduringa2yearfollowup‏ ‎‡A Human Papillomavirus (HPV) type 16 and type 18 DNA Loads at Baseline and Persistence of Type-Specific Infection during a 2-year follow-up‏ ‎‡9 1‏
919 ‎‡a humanimmunodeficiencyvirusisassociatedwithhigherlevelsofsystemicinflammationamongkenyanadultsdespiteviralsuppression‏ ‎‡A Human Immunodeficiency Virus Is Associated With Higher Levels of Systemic Inflammation Among Kenyan Adults Despite Viral Suppression‏ ‎‡9 1‏
919 ‎‡a hptn078highprevalenceofhcvantibodiesamongurbanusmenwhohavesexwithmenmsmindependentofhivstatus‏ ‎‡A HPTN 078: High Prevalence of HCV Antibodies Among Urban U.S. Men Who Have Sex with Men (MSM) Independent of HIV Status‏ ‎‡9 1‏
919 ‎‡a hptn068arandomizedcontroltrialofaconditionalcashtransfertoreducehivinfectioninyoungwomeninsouthafricastudydesignandbaselineresults‏ ‎‡A HPTN 068: A Randomized Control Trial of a Conditional Cash Transfer to Reduce HIV Infection in Young Women in South Africa-Study Design and Baseline Results‏ ‎‡9 1‏
919 ‎‡a hptn067adaptcorrelatesofsexrelatedpreexposureprophylaxisadherencethaimenwhohavesexwithmenandtransgenderwomen2012‏ ‎‡A HPTN 067/ADAPT: Correlates of Sex-Related Pre-exposure Prophylaxis Adherence, Thai Men Who Have Sex With Men, and Transgender Women, 2012-2013‏ ‎‡9 1‏
919 ‎‡a hostgeneticandviraldeterminantsofhiv1rnasetpointamonghiv1seroconvertersfromsubsaharanafrica‏ ‎‡A Host genetic and viral determinants of HIV-1 RNA set point among HIV-1 seroconverters from sub-saharan Africa‏ ‎‡9 1‏
919 ‎‡a hometestingandcounsellingtoreducehivincidenceinageneralisedepidemicsettingamathematicalmodellinganalysis‏ ‎‡A Home testing and counselling to reduce HIV incidence in a generalised epidemic setting: a mathematical modelling analysis‏ ‎‡9 1‏
919 ‎‡a hivtestingfrequencyamongmenwhohavesexwithmenattendingsexuallytransmitteddiseaseclinicsimplicationsforhivpreventionandsurveillance‏ ‎‡A HIV testing frequency among men who have sex with men attending sexually transmitted disease clinics: implications for HIV prevention and surveillance‏ ‎‡9 1‏
919 ‎‡a hivserosortinginmenwhohavesexwithmenisitsafe‏ ‎‡A HIV serosorting in men who have sex with men: is it safe?‏ ‎‡9 1‏
919 ‎‡a hivselftestingincreaseshivtestingfrequencyinhighriskmenwhohavesexwithmenarandomizedcontrolledtrial‏ ‎‡A HIV Self-Testing Increases HIV Testing Frequency in High Risk Men Who Have Sex with Men: A Randomized Controlled Trial.‏ ‎‡9 1‏
919 ‎‡a hivriskcharacteristicsassociatedwithviolenceagainstwomenalongitudinalstudyamongwomenintheunitedstates‏ ‎‡A HIV Risk Characteristics Associated with Violence Against Women: A Longitudinal Study Among Women in the United States‏ ‎‡9 1‏
919 ‎‡a hivdrugresistanceinacohortofhivinfectedmsmintheunitedstates‏ ‎‡A HIV drug resistance in a cohort of HIV-infected MSM in the United States‏ ‎‡9 1‏
919 ‎‡a hivacquisitionamongwomenfromselectedareasoftheunitedstatesacohortstudy‏ ‎‡A HIV acquisition among women from selected areas of the United States: a cohort study‏ ‎‡9 1‏
919 ‎‡a hiv1sexuallytransmittedinfectionsandsexualbehaviortrendsamongmenwhohavesexwithmeninlimaperu‏ ‎‡A HIV-1, sexually transmitted infections, and sexual behavior trends among men who have sex with men in Lima, Peru.‏ ‎‡9 1‏
919 ‎‡a hiv1diversityamongyoungwomeninruralsouthafricahptn068‏ ‎‡A HIV-1 diversity among young women in rural South Africa: HPTN 068.‏ ‎‡9 1‏
919 ‎‡a higherconcentrationofhivrnainrectalmucosasecretionsthaninbloodandseminalplasmaamongmenwhohavesexwithmenindependentofantiretroviraltherapy‏ ‎‡A Higher concentration of HIV RNA in rectal mucosa secretions than in blood and seminal plasma, among men who have sex with men, independent of antiretroviral therapy‏ ‎‡9 1‏
919 ‎‡a highratesofexclusivebreastfeedinginbotharmsofapeercounselingstudypromotingebfamonghivinfectedkenyanwomen‏ ‎‡A High Rates of Exclusive Breastfeeding in Both Arms of a Peer Counseling Study Promoting EBF Among HIV-Infected Kenyan Women‏ ‎‡9 1‏
919 ‎‡a highhivtestinguptakeandlinkagetocareinanovelprogramofhomebasedhivcounselingandtestingwithfacilitatedreferralinkwazulunatalsouthafrica‏ ‎‡A High HIV testing uptake and linkage to care in a novel program of home-based HIV counseling and testing with facilitated referral in KwaZulu-Natal, South Africa‏ ‎‡9 1‏
919 ‎‡a healthfacilitydeterminantsandtrendsoficd10outpatientpsychiatricconsultationsacrosssofalamozambiquetimeseriesanalysesfrom2012to‏ ‎‡A Health facility determinants and trends of ICD-10 outpatient psychiatric consultations across Sofala, Mozambique: time-series analyses from 2012 to 2014.‏ ‎‡9 1‏
919 ‎‡a hbvinfectioninrelationtoconsistentcondomuseapopulationbasedstudyinperu‏ ‎‡A HBV infection in relation to consistent condom use: a population-based study in Peru‏ ‎‡9 1‏
919 ‎‡a handheldcomputersforselfadministeredsensitivedatacollectionacomparativestudyinperu‏ ‎‡A Handheld computers for self-administered sensitive data collection: a comparative study in Peru‏ ‎‡9 1‏
919 ‎‡a gentamicinaloneinadequatetoeradicateneisseriagonorrhoeaefromthepharynx‏ ‎‡A Gentamicin Alone Inadequate to Eradicate Neisseria Gonorrhoeae from the Pharynx‏ ‎‡9 1‏
919 ‎‡a genitalhumanpapillomavirusinfectionincidenceandriskfactorsinacohortoffemaleuniversitystudents‏ ‎‡A Genital human papillomavirus infection: incidence and risk factors in a cohort of female university students‏ ‎‡9 1‏
919 ‎‡a genitalhumanpapillomavirusinfectioninmenincidenceandriskfactorsinacohortofuniversitystudents‏ ‎‡A Genital human papillomavirus infection in men: incidence and risk factors in a cohort of university students‏ ‎‡9 1‏
919 ‎‡a frequencyandpredictorsofestimatedhivtransmissionsandbacterialstiacquisitionamonghivpositivepatientsinhivcareacross3continents‏ ‎‡A Frequency and predictors of estimated HIV transmissions and bacterial STI acquisition among HIV-positive patients in HIV care across three continents‏ ‎‡9 1‏
919 ‎‡a factorsassociatedwithsexrelatedpreexposureprophylaxisadherenceamongmenwhohavesexwithmeninnewyorkcityinhptn067‏ ‎‡A Factors Associated With Sex-Related Pre-exposure Prophylaxis Adherence Among Men Who Have Sex With Men in New York City in HPTN 067‏ ‎‡9 1‏
919 ‎‡a factorsassociatedwithoropharyngealhumanimmunodeficiencyvirusshedding‏ ‎‡A Factors associated with oropharyngeal human immunodeficiency virus shedding‏ ‎‡9 1‏
919 ‎‡a expeditedpartnertherapyarobustintervention‏ ‎‡A Expedited partner therapy: a robust intervention‏ ‎‡9 1‏
919 ‎‡a executivefunctionassociatedwithsexualriskinyoungsouthafricanwomenfindingsfromthehptn068cohort‏ ‎‡A Executive function associated with sexual risk in young South African women: Findings from the HPTN 068 cohort.‏ ‎‡9 1‏
919 ‎‡a evidenceofimmunememory85yearsfollowingadministrationofaprophylactichumanpapillomavirustype16vaccine‏ ‎‡A Evidence of immune memory 8.5 years following administration of a prophylactic human papillomavirus type 16 vaccine‏ ‎‡9 1‏
919 ‎‡a evidenceforsampleselectioneffectandhawthorneeffectinbehaviouralhivpreventiontrialamongyoungwomeninaruralsouthafricancommunity‏ ‎‡A Evidence for sample selection effect and Hawthorne effect in behavioural HIV prevention trial among young women in a rural South African community‏ ‎‡9 1‏
919 ‎‡a evaluationofprimarycervicalcancerscreeningwithanoncogenichumanpapillomavirusdnatestandcervicalcytologicfindingsamongwomenwhoattendedfamilyplanningclinicsintheunitedstates‏ ‎‡A Evaluation of primary cervical cancer screening with an oncogenic human papillomavirus DNA test and cervical cytologic findings among women who attended family planning clinics in the United States‏ ‎‡9 1‏
919 ‎‡a evaluationofhumanpapillomavirustestinginprimaryscreeningforcervicalabnormalitiescomparisonofsensitivityspecificityandfrequencyofreferral‏ ‎‡A Evaluation of human papillomavirus testing in primary screening for cervical abnormalities: comparison of sensitivity, specificity, and frequency of referral‏ ‎‡9 1‏
919 ‎‡a evaluationofdryandwettransportofathomeselfcollectedvaginalswabsforhumanpapillomavirustesting‏ ‎‡A Evaluation of dry and wet transport of at-home self-collected vaginal swabs for human papillomavirus testing‏ ‎‡9 1‏
919 ‎‡a evaluationofanemergencydepartmentandhospitalbaseddataexchangetoimprovehivcareengagementandviralsuppression‏ ‎‡A Evaluation of an emergency department and hospital-based data exchange to improve HIV care engagement and viral suppression‏ ‎‡9 1‏
919 ‎‡a evaluationofapopulationbasedprogramofexpeditedpartnertherapyforgonorrheaandchlamydialinfection‏ ‎‡A Evaluation of a population-based program of expedited partner therapy for gonorrhea and chlamydial infection‏ ‎‡9 1‏
919 ‎‡a evaluationofacomputerbasedrecruitmentsystemforenrollingmenwhohavesexwithmenintoanobservationalhivbehavioralriskstudy‏ ‎‡A Evaluation of a Computer-Based Recruitment System for Enrolling Men Who Have Sex With Men Into an Observational HIV Behavioral Risk Study‏ ‎‡9 1‏
919 ‎‡a estimatingtheimpactofplasmahiv1rnareductionsonheterosexualhiv1transmissionrisk‏ ‎‡A Estimating the impact of plasma HIV-1 RNA reductions on heterosexual HIV-1 transmission risk‏ ‎‡9 1‏
919 ‎‡a estimatingtheefficacyofpreexposureprophylaxisforhivpreventionamongparticipantswithathresholdlevelofdrugconcentration‏ ‎‡A Estimating the efficacy of preexposure prophylaxis for HIV prevention among participants with a threshold level of drug concentration‏ ‎‡9 1‏
919 ‎‡a estimatingdurationinpartnershipstudiesissuesmethodsandexamples‏ ‎‡A Estimating duration in partnership studies: issues, methods and examples‏ ‎‡9 1‏
919 ‎‡a epidemiologyofhumanpapillomavirusdetectedintheoralcavityandfingernailsofmidadultwomen‏ ‎‡A Epidemiology of Human Papillomavirus Detected in the Oral Cavity and Fingernails of Mid-Adult Women‏ ‎‡9 1‏
919 ‎‡a effectofexpeditedtreatmentofsexpartnersonrecurrentorpersistentgonorrheaorchlamydialinfection‏ ‎‡A Effect of expedited treatment of sex partners on recurrent or persistent gonorrhea or chlamydial infection‏ ‎‡9 1‏
919 ‎‡a effectofcondomuseonperacthsv2transmissionriskinhiv1hsv2discordantcouples‏ ‎‡A Effect of Condom Use on Per-act HSV-2 Transmission Risk in HIV-1, HSV-2-discordant Couples‏ ‎‡9 1‏
919 ‎‡a effectofacyclovironhiv1setpointamongherpessimplexvirustype2seropositivepersonsduringearlyhiv1infection‏ ‎‡A Effect of acyclovir on HIV-1 set point among herpes simplex virus type 2-seropositive persons during early HIV-1 infection‏ ‎‡9 1‏
919 ‎‡a effectofaciclovironhiv1acquisitioninherpessimplexvirus2seropositivewomenandmenwhohavesexwithmenarandomiseddoubleblindplacebocontrolledtrial‏ ‎‡A Effect of aciclovir on HIV-1 acquisition in herpes simplex virus 2 seropositive women and men who have sex with men: a randomised, double-blind, placebo-controlled trial‏ ‎‡9 1‏
919 ‎‡a earlynaturalhistoryofincidenttypespecifichumanpapillomavirusinfectionsinnewlysexuallyactiveyoungwomen‏ ‎‡A Early natural history of incident, type-specific human papillomavirus infections in newly sexually active young women‏ ‎‡9 1‏
919 ‎‡a doespartnerselectionmediatetherelationshipbetweenschoolattendanceandhivherpessimplexvirus2amongadolescentgirlsandyoungwomeninsouthafricaananalysisofhivpreventiontrialsnetwork068data‏ ‎‡A Does Partner Selection Mediate the Relationship Between School Attendance and HIV/Herpes Simplex Virus-2 Among Adolescent Girls and Young Women in South Africa: An Analysis of HIV Prevention Trials Network 068 Data‏ ‎‡9 1‏
919 ‎‡a discreteproportionalhazardsmodelsformismeasuredoutcomes‏ ‎‡A Discrete proportional hazards models for mismeasured outcomes‏ ‎‡9 1‏
919 ‎‡a discoveryofgeneticvariantsofthekinasesthatactivatetenofoviramongindividualsintheunitedstatesthailandandsouthafricahptn067‏ ‎‡A Discovery of genetic variants of the kinases that activate tenofovir among individuals in the United States, Thailand, and South Africa: HPTN067.‏ ‎‡9 1‏
919 ‎‡a disclosureofgenitalhumanpapillomavirusinfectiontofemalesexpartnersbyyoungmen‏ ‎‡A Disclosure of genital human papillomavirus infection to female sex partners by young men.‏ ‎‡9 1‏
919 ‎‡a difficultiesinestimatingthemaletofemalesexualtransmissibilityofhumanpapillomavirusinfection‏ ‎‡A Difficulties in estimating the male-to-female sexual transmissibility of human papillomavirus infection‏ ‎‡9 1‏
919 ‎‡a differencesinvirologicandimmunologicresponsetoantiretroviraltherapyamonghiv1infectedinfantsandchildren‏ ‎‡A Differences in virologic and immunologic response to antiretroviral therapy among HIV-1-infected infants and children‏ ‎‡9 1‏
919 ‎‡a developmentofgenitalwartsafterincidentdetectionofhumanpapillomavirusinfectioninyoungmen‏ ‎‡A Development of Genital Warts after Incident Detection of Human Papillomavirus Infection in Young Men‏ ‎‡9 1‏
919 ‎‡a developmentanddurationofhumanpapillomaviruslesionsafterinitialinfection‏ ‎‡A Development and duration of human papillomavirus lesions, after initial infection‏ ‎‡9 1‏
919 ‎‡a determinantsofpercoitalacthiv1infectivityamongafricanhiv1serodiscordantcouples‏ ‎‡A Determinants of per-coital-act HIV-1 infectivity among African HIV-1-serodiscordant couples‏ ‎‡9 1‏
919 ‎‡a determinantsofcervicalcancerratesindevelopingcountries‏ ‎‡A Determinants of cervical cancer rates in developing countries‏ ‎‡9 1‏
919 ‎‡a detectionofgenitalhpvtypesinfingertipsamplesfromnewlysexuallyactivefemaleuniversitystudents‏ ‎‡A Detection of Genital HPV Types in Fingertip Samples from Newly Sexually Active Female University Students‏ ‎‡9 1‏
919 ‎‡a derivationandvalidationofanhivriskpredictionscoreamonggaybisexualandothermenwhohavesexwithmentoinformprepinitiationinanstdclinicsetting‏ ‎‡A Derivation and Validation of an HIV Risk Prediction Score Among Gay, Bisexual and Other Men Who Have Sex With Men to Inform PrEP Initiation in an STD Clinic Setting‏ ‎‡9 1‏
919 ‎‡a depressionandincidenthivinadolescentgirlsandyoungwomeninhptn068targetsforpreventionandmediatingfactors‏ ‎‡A Depression and incident HIV in adolescent girls and young women in HPTN 068: Targets for prevention and mediating factors‏ ‎‡9 1‏
919 ‎‡a dailyandnondailyoralpreexposureprophylaxisinmenandtransgenderwomenwhohavesexwithmenthehumanimmunodeficiencyviruspreventiontrialsnetwork067adaptstudy‏ ‎‡A Daily and Nondaily Oral Preexposure Prophylaxis in Men and Transgender Women Who Have Sex With Men: The Human Immunodeficiency Virus Prevention Trials Network 067/ADAPT Study‏ ‎‡9 1‏
919 ‎‡a dailyandnondailypreexposureprophylaxisinafricanwomenhptn067adaptcapetowntrialarandomisedopenlabelphase2trial‏ ‎‡A Daily and non-daily pre-exposure prophylaxis in African women (HPTN 067/ADAPT Cape Town Trial): a randomised, open-label, phase 2 trial‏ ‎‡9 1‏
919 ‎‡a dailyacyclovirforhiv1diseaseprogressioninpeopleduallyinfectedwithhiv1andherpessimplexvirustype2arandomisedplacebocontrolledtrial‏ ‎‡A Daily acyclovir for HIV-1 disease progression in people dually infected with HIV-1 and herpes simplex virus type 2: a randomised placebo-controlled trial‏ ‎‡9 1‏
919 ‎‡a crosssectionalstudyofurethralexposuresatlastsexualepisodeassociatedwithnongonococcalurethritisamongstdclinicpatients‏ ‎‡A Cross-sectional study of urethral exposures at last sexual episode associated with non-gonococcal urethritis among STD clinic patients‏ ‎‡9 1‏
919 ‎‡a correlatesofnationalhivseroprevalenceanecologicanalysisof122developingcountries‏ ‎‡A Correlates of national HIV seroprevalence: an ecologic analysis of 122 developing countries.‏ ‎‡9 1‏
919 ‎‡a contingencymanagementtoreducemethamphetamineuseandsexualriskamongmenwhohavesexwithmenarandomizedcontrolledtrial‏ ‎‡A Contingency management to reduce methamphetamine use and sexual risk among men who have sex with men: a randomized controlled trial‏ ‎‡9 1‏
919 ‎‡a condomuseandtheriskofgenitalhumanpapillomavirusinfectioninyoungwomen‏ ‎‡A Condom use and the risk of genital human papillomavirus infection in young women‏ ‎‡9 1‏
919 ‎‡a conditionalcashtransfersandthereductioninpartnerviolenceforyoungwomenaninvestigationofcausalpathwaysusingevidencefromarandomizedexperimentinsouthafricahptn068‏ ‎‡A Conditional cash transfers and the reduction in partner violence for young women: an investigation of causal pathways using evidence from a randomized experiment in South Africa (HPTN 068).‏ ‎‡9 1‏
919 ‎‡a conditionalcashtransfersandthereductioninpartnerviolenceforyoungwomenaninvestigationofcausalpathwaysusingevidencefromarandomizedexperimentinsouthafrica‏ ‎‡A Conditional cash transfers and the reduction in partner violence for young women: an investigation of causal pathways using evidence from a randomized experiment in South Africa‏ ‎‡9 1‏
919 ‎‡a concordanceofselfcollectedandcliniciancollectedswabsamplesfordetectinghumanpapillomavirusdnainwomen18to32yearsofage‏ ‎‡A Concordance of self-collected and clinician-collected swab samples for detecting human papillomavirus DNA in women 18 to 32 years of age.‏ ‎‡9 1‏
919 ‎‡a completionofthetuberculosiscarecascadeinacommunitybasedhivlinkagetocarestudyinsouthafricaanduganda‏ ‎‡A Completion of the tuberculosis care cascade in a community-based HIV linkage-to-care study in South Africa and Uganda‏ ‎‡9 1‏
919 ‎‡a comparisonoforalfluidandserumelisasinthedeterminationofiggresponsetonaturalhumanpapillomavirusinfectioninuniversitywomen‏ ‎‡A Comparison of oral fluid and serum ELISAs in the determination of IgG response to natural human papillomavirus infection in university women.‏ ‎‡9 1‏
919 ‎‡a comparisonofincidentcervicalandvulvarvaginalhumanpapillomavirusinfectionsinnewlysexuallyactiveyoungwomen‏ ‎‡A Comparison of incident cervical and vulvar/vaginal human papillomavirus infections in newly sexually active young women‏ ‎‡9 1‏
919 ‎‡a comparingmethodsforrecordlinkageforpublichealthactionmatchingalgorithmvalidationstudy‏ ‎‡A Comparing Methods for Record Linkage for Public Health Action: Matching Algorithm Validation Study‏ ‎‡9 1‏
919 ‎‡a clinicalfindingsamongyoungwomenwithgenitalhumanpapillomavirusinfection‏ ‎‡A Clinical findings among young women with genital human papillomavirus infection‏ ‎‡9 1‏
919 ‎‡a clinicalandvirologicresponsetoepisodicacyclovirforgenitalulcersamonghiv1seronegativeherpessimplexvirustype2seropositiveafricanwomenarandomizedplacebocontrolledtrial‏ ‎‡A Clinical and virologic response to episodic acyclovir for genital ulcers among HIV-1 seronegative, herpes simplex virus type 2 seropositive African women: a randomized, placebo-controlled trial‏ ‎‡9 1‏
919 ‎‡a clinicalandvirologicefficacyofherpessimplexvirustype2suppressionbyacyclovirinamulticontinentclinicaltrial‏ ‎‡A Clinical and virologic efficacy of herpes simplex virus type 2 suppression by acyclovir in a multicontinent clinical trial‏ ‎‡9 1‏
919 ‎‡a clandestineinducedabortionprevalenceincidenceandriskfactorsamongwomeninalatinamericancountry‏ ‎‡A Clandestine induced abortion: prevalence, incidence and risk factors among women in a Latin American country‏ ‎‡9 1‏
919 ‎‡a circumcisionandacquisitionofhumanpapillomavirusinfectioninyoungmen‏ ‎‡A Circumcision and acquisition of human papillomavirus infection in young men.‏ ‎‡9 1‏
919 ‎‡a choosingametricformeasurementofpreexposureprophylaxis‏ ‎‡A Choosing a metric for measurement of pre-exposure prophylaxis‏ ‎‡9 1‏
919 ‎‡a chlamydiascreeningcoverageestimatesderivedusinghealthcareeffectivenessdataandinformationsystemproceduresandindirectestimationvarysubstantially‏ ‎‡A Chlamydia screening coverage estimates derived using healthcare effectiveness data and information system procedures and indirect estimation vary substantially‏ ‎‡9 1‏
919 ‎‡a characterizationofigaresponseamongwomenwithincidenthpv16infection‏ ‎‡A Characterization of IgA response among women with incident HPV 16 infection‏ ‎‡9 1‏
919 ‎‡a characterizationofhivseroconvertersinatdfftcprepstudyhptn067adapt‏ ‎‡A Characterization of HIV Seroconverters in a TDF/FTC PrEP Study: HPTN 067/ADAPT.‏ ‎‡9 1‏
919 ‎‡a characteristicsofmultipleandconcurrentpartnershipsamongwomenathighriskforhivinfection‏ ‎‡A Characteristics of multiple and concurrent partnerships among women at high risk for HIV infection‏ ‎‡9 1‏
919 ‎‡a characteristicsofcovid19inhomelesssheltersacommunitybasedsurveillancestudy‏ ‎‡A Characteristics of COVID-19 in Homeless Shelters: A Community-Based Surveillance Study‏ ‎‡9 1‏
919 ‎‡a characteristicsofagediscordantpartnershipsassociatedwithhivriskamongyoungsouthafricanwomenhptn068‏ ‎‡A Characteristics of Age-Discordant Partnerships Associated With HIV Risk Among Young South African Women (HPTN 068).‏ ‎‡9 1‏
919 ‎‡a characteristicsassociatedwithhumanimmunodeficiencyvirustransmissionnetworksinvolvingadolescentgirlsandyoungwomeninhumanimmunodeficiencyviruspreventiontrialsnetwork068study‏ ‎‡A Characteristics Associated With Human Immunodeficiency Virus Transmission Networks Involving Adolescent Girls and Young Women in Human Immunodeficiency Virus Prevention Trials Network 068 Study‏ ‎‡9 1‏
919 ‎‡a clusterrandomizedevaluationofahealthdepartmentdatatocareinterventiondesignedtoincreaseengagementinhivcareandantiretroviraluse‏ ‎‡A A Cluster Randomized Evaluation of a Health Department Data to Care Intervention Designed to Increase Engagement in HIV Care and Antiretroviral Use.‏ ‎‡9 1‏
919 ‎‡a populationbasedstudytocomparetreatmentoutcomesamongwomenwithurogenitalchlamydialinfectioninwashingtonstate1992‏ ‎‡A A population-based study to compare treatment outcomes among women with urogenital chlamydial infection in Washington State, 1992-2015.‏ ‎‡9 1‏
919 ‎‡a posttrialassessmentoffactorsinfluencingstudydrugadherenceinarandomizedbiomedicalhiv1preventiontrial‏ ‎‡A A post-trial assessment of factors influencing study drug adherence in a randomized biomedical HIV-1 prevention trial‏ ‎‡9 1‏
919 ‎‡a prospectivecohortstudyofintimatepartnerviolenceandunprotectedsexinhivpositivefemalesexworkersinmombasakenya‏ ‎‡A A Prospective Cohort Study of Intimate Partner Violence and Unprotected Sex in HIV-Positive Female Sex Workers in Mombasa, Kenya‏ ‎‡9 1‏
919 ‎‡a prospectivestudyofintimatepartnerviolenceasariskfactorfordetectableplasmaviralloadinhivpositivewomenengagedintransactionalsexinmombasakenya‏ ‎‡A A Prospective Study of Intimate Partner Violence as a Risk Factor for Detectable Plasma Viral Load in HIV-Positive Women Engaged in Transactional Sex in Mombasa, Kenya.‏ ‎‡9 1‏
919 ‎‡a absenceofanassociationofhumanpolyomavirusandpapillomavirusinfectionwithlungcancerinchinaanestedcasecontrolstudy‏ ‎‡A Absence of an association of human polyomavirus and papillomavirus infection with lung cancer in China: a nested case-control study‏ ‎‡9 1‏
919 ‎‡a changesindnalevelofoncogenichumanpapillomavirusesotherthantypes16and18inrelationtoriskofcervicalintraepithelialneoplasiagrades2and3‏ ‎‡A Changes in DNA Level of Oncogenic Human Papillomaviruses Other Than Types 16 and 18 in Relation to Risk of Cervical Intraepithelial Neoplasia Grades 2 and 3‏ ‎‡9 1‏
919 ‎‡a challengesinthedesignofhivpreventiontrialsintheunitedstates‏ ‎‡A Challenges in the design of HIV prevention trials in the United States‏ ‎‡9 1‏
919 ‎‡a cashtransfersyoungwomenseconomicwellbeingandhivriskevidencefromhptn068‏ ‎‡A Cash Transfers, Young Women's Economic Well-Being, and HIV Risk: Evidence from HPTN 068‏ ‎‡9 1‏
919 ‎‡a breastmilkinfectivityinhumanimmunodeficiencyvirustype1infectedmothers‏ ‎‡A Breast-milk infectivity in human immunodeficiency virus type 1-infected mothers‏ ‎‡9 1‏
919 ‎‡a associationofrecentbacterialvaginosiswithacquisitionofmycoplasmagenitalium‏ ‎‡A Association of Recent Bacterial Vaginosis With Acquisition of Mycoplasma genitalium‏ ‎‡9 1‏
919 ‎‡a assessingtheuseofsurveillancedatatoestimatetheimpactofpreventioninterventionsonhivincidenceinclusterrandomizedcontrolledtrials‏ ‎‡A Assessing the use of surveillance data to estimate the impact of prevention interventions on HIV incidence in cluster-randomized controlled trials‏ ‎‡9 1‏
919 ‎‡a assessingriskforhivinfectionamongadolescentgirlsinsouthafricaanevaluationofthevoiceriskscorehptn068‏ ‎‡A Assessing risk for HIV infection among adolescent girls in South Africa: an evaluation of the VOICE risk score (HPTN 068)‏ ‎‡9 1‏
919 ‎‡a antiretroviralmedicationadherenceandamplifiedhivtransmissionriskamongsexuallyactivehivinfectedindividualsin3diverseinternationalsettings‏ ‎‡A Antiretroviral Medication Adherence and Amplified HIV Transmission Risk Among Sexually Active HIV-Infected Individuals in Three Diverse International Settings‏ ‎‡9 1‏
919 ‎‡a antiretroviraldruguseinacohortofhivuninfectedwomenintheunitedstateshivpreventiontrialsnetwork064‏ ‎‡A Antiretroviral Drug Use in a Cohort of HIV-Uninfected Women in the United States: HIV Prevention Trials Network 064‏ ‎‡9 1‏
919 ‎‡a antiretroviraldruguseandhivdrugresistanceamongyoungwomeninruralsouthafricahptn068‏ ‎‡A Antiretroviral Drug Use and HIV Drug Resistance Among Young Women in Rural South Africa: HPTN 068‏ ‎‡9 1‏
919 ‎‡a antibodyresponsesinoralfluidafteradministrationofprophylactichumanpapillomavirusvaccines‏ ‎‡A Antibody responses in oral fluid after administration of prophylactic human papillomavirus vaccines‏ ‎‡9 1‏
919 ‎‡a analysisofliquidbeadmicroarrayantibodyassaydataforepidemiologicstudiesofpathogencancerassociations‏ ‎‡A Analysis of liquid bead microarray antibody assay data for epidemiologic studies of pathogen-cancer associations‏ ‎‡9 1‏
919 ‎‡a analysisofgeneticlinkageofhivfromcouplesenrolledinthehivpreventiontrialsnetwork052trial‏ ‎‡A Analysis of genetic linkage of HIV from couples enrolled in the HIV Prevention Trials Network 052 trial‏ ‎‡9 1‏
919 ‎‡a evaluationofhivpartnercounselingandreferralservicesusingnewdispositioncodes‏ ‎‡A An evaluation of HIV partner counseling and referral services using new disposition codes‏ ‎‡9 1‏
919 ‎‡a empiricriskscoringtoolforidentifyinghighriskheterosexualhiv1serodiscordantcouplesfortargetedhiv1prevention‏ ‎‡A An empiric risk scoring tool for identifying high-risk heterosexual HIV-1-serodiscordant couples for targeted HIV-1 prevention‏ ‎‡9 1‏
919 ‎‡a assessmentoftheaccuracyandavailabilityofdatainelectronicpatienttrackingsystemsforpatientsreceivinghivtreatmentincentralmozambique‏ ‎‡A An assessment of the accuracy and availability of data in electronic patient tracking systems for patients receiving HIV treatment in central Mozambique‏ ‎‡9 1‏
919 ‎‡a accuracyandcosteffectivenessofcervicalcancerscreeningbyhighriskhumanpapillomavirusdnatestingofselfcollectedvaginalsamples‏ ‎‡A Accuracy and cost-effectiveness of cervical cancer screening by high-risk human papillomavirus DNA testing of self-collected vaginal samples‏ ‎‡9 1‏
919 ‎‡a ageofdiagnosisofsquamouscellcervicalcarcinomaandearlysexualexperience‏ ‎‡A Age of diagnosis of squamous cell cervical carcinoma and early sexual experience‏ ‎‡9 1‏
919 ‎‡a acquisitionandnaturalhistoryofhumanpapillomavirustype16variantinfectionamongacohortoffemaleuniversitystudents‏ ‎‡A Acquisition and natural history of human papillomavirus type 16 variant infection among a cohort of female university students‏ ‎‡9 1‏
919 ‎‡a agedisparatepartnershipsandincidenthivinfectioninadolescentgirlsandyoungwomeninruralsouthafricaanhptn068analysis‏ ‎‡A Age-disparate partnerships and incident HIV infection in adolescent girls and young women in rural South Africa: An HPTN 068 analysis‏ ‎‡9 1‏
919 ‎‡a acyclovirachievesalowerconcentrationinafricanhivseronegativeherpessimplexvirus2seropositivewomenthaninnonafricanpopulations‏ ‎‡A Acyclovir achieves a lower concentration in African HIV-seronegative, herpes simplex virus 2-seropositive women than in non-African populations‏ ‎‡9 1‏
919 ‎‡a ageandgenderspecificestimatesofpartnershipformationanddissolutionratesintheseattlesexsurvey‏ ‎‡A Age- and gender-specific estimates of partnership formation and dissolution rates in the Seattle sex survey‏ ‎‡9 1‏
919 ‎‡a acyclovirprophylaxisreducestheincidenceofherpeszosteramonghivinfectedindividualsresultsofarandomizedclinicaltrial‏ ‎‡A Acyclovir Prophylaxis Reduces the Incidence of Herpes Zoster Among HIV-Infected Individuals: Results of a Randomized Clinical Trial‏ ‎‡9 1‏
943 ‎‡a 146x‏ ‎‡A 1461‏ ‎‡9 2‏
943 ‎‡a 201x‏ ‎‡A 2013‏ ‎‡9 3‏
946 ‎‡a b‏ ‎‡9 1‏
996 ‎‡2 B2Q|0000287395
996 ‎‡2 ISNI|0000000390552716
996 ‎‡2 LC|no2008012540
996 ‎‡2 NTA|072364157
996 ‎‡2 B2Q|0001216747
996 ‎‡2 LC|no2020040632
996 ‎‡2 SUDOC|030914663
996 ‎‡2 LC|no2024128470
996 ‎‡2 DNB|1050397266
996 ‎‡2 SUDOC|077694813
996 ‎‡2 DNB|173606814
996 ‎‡2 CAOONL|ncf10106537
996 ‎‡2 LC|n 85100272
996 ‎‡2 BIBSYS|90632220
996 ‎‡2 LC|no2009063860
996 ‎‡2 LC|nr 93009184
996 ‎‡2 NKC|xx0076487
996 ‎‡2 SUDOC|131561146
996 ‎‡2 BIBSYS|90502137
996 ‎‡2 J9U|987007289218505171
996 ‎‡2 NKC|jn19990003733
996 ‎‡2 NUKAT|n 2003039996
996 ‎‡2 PTBNP|236896
996 ‎‡2 J9U|987007350486705171
996 ‎‡2 ISNI|0000000041597801
996 ‎‡2 ISNI|0000000047431060
996 ‎‡2 ISNI|0000000043431194
996 ‎‡2 SKMASNL|vtls007074469
996 ‎‡2 LC|no2022029272
996 ‎‡2 LC|nb2017007521
996 ‎‡2 NKC|nlk20030131360
996 ‎‡2 ISNI|0000000497069660
996 ‎‡2 NUKAT|n 2013006124
996 ‎‡2 BIBSYS|90817486
996 ‎‡2 SUDOC|170581365
996 ‎‡2 ISNI|0000000081917689
996 ‎‡2 NII|DA03864775
996 ‎‡2 BNC|981058612301106706
996 ‎‡2 DNB|1217217371
996 ‎‡2 SUDOC|081832206
996 ‎‡2 DBC|87097969524656
996 ‎‡2 LC|n 2011074100
996 ‎‡2 NTA|069155437
996 ‎‡2 ISNI|0000000397253823
996 ‎‡2 SUDOC|18886282X
996 ‎‡2 LC|no2010030682
996 ‎‡2 DNB|172147093
996 ‎‡2 LC|nb2012025471
996 ‎‡2 LC|no2018152755
996 ‎‡2 CAOONL|ncf11299198
996 ‎‡2 B2Q|0000059045
996 ‎‡2 ISNI|0000000499409200
996 ‎‡2 LC|n 80015803
996 ‎‡2 SUDOC|261083600
996 ‎‡2 NUKAT|n 2011156191
996 ‎‡2 ISNI|0000000053814447
996 ‎‡2 BIBSYS|90130254
996 ‎‡2 LC|n 88200902
996 ‎‡2 NUKAT|n 2016147525
996 ‎‡2 LC|n 97878645
996 ‎‡2 LNB|LNC10-000019531
996 ‎‡2 SUDOC|119289997
996 ‎‡2 LC|no2009182670
996 ‎‡2 ISNI|000000004087634X
996 ‎‡2 J9U|987007390850105171
996 ‎‡2 LC|no2004109980
996 ‎‡2 CAOONL|ncf10621336
996 ‎‡2 SUDOC|271546603
996 ‎‡2 ISNI|0000000418690257
996 ‎‡2 NTA|277351278
996 ‎‡2 LC|n 2002022237
996 ‎‡2 BIBSYS|90259000
996 ‎‡2 LC|n 83305557
996 ‎‡2 LC|no 97044178
996 ‎‡2 LC|no2012121310
996 ‎‡2 BNF|17725135
996 ‎‡2 BNC|981061108275306706
996 ‎‡2 NII|DA07189084
996 ‎‡2 J9U|987007448914005171
996 ‎‡2 LC|no2013073822
996 ‎‡2 J9U|987007314980605171
996 ‎‡2 LC|n 2004017364
996 ‎‡2 NII|DA00687425
996 ‎‡2 ISNI|0000000026246288
996 ‎‡2 ISNI|0000000044759036
996 ‎‡2 ISNI|0000000390112876
996 ‎‡2 PLWABN|9810555953305606
996 ‎‡2 LC|no2019002805
996 ‎‡2 J9U|987011288992005171
996 ‎‡2 LIH|LNB:V-77840;=BM
996 ‎‡2 J9U|987007577254405171
996 ‎‡2 LC|no2010188592
996 ‎‡2 RERO|A003388742
996 ‎‡2 LC|no2013039754
996 ‎‡2 LIH|LNB:C_g__z_G;=B7
996 ‎‡2 LC|no2018089154
996 ‎‡2 ISNI|0000000070425144
996 ‎‡2 CAOONL|ncf10428003
996 ‎‡2 ISNI|0000000027350204
996 ‎‡2 SUDOC|032476027
996 ‎‡2 LC|n 2017023856
996 ‎‡2 J9U|987007279631205171
996 ‎‡2 NTA|072411538
996 ‎‡2 BNE|XX1186702
996 ‎‡2 ISNI|0000000438134944
996 ‎‡2 LC|no2015065350
996 ‎‡2 NUKAT|n 2004030203
996 ‎‡2 LC|n 78003099
996 ‎‡2 LC|n 85312917
996 ‎‡2 ISNI|0000000399594752
996 ‎‡2 SUDOC|279200919
996 ‎‡2 DNB|128747943
996 ‎‡2 BIBSYS|90227449
996 ‎‡2 ISNI|0000000053354065
996 ‎‡2 N6I|vtls002200887
996 ‎‡2 J9U|987007262874205171
996 ‎‡2 ISNI|0000000071115949
996 ‎‡2 LC|n 83052628
996 ‎‡2 BNF|12534531
996 ‎‡2 NTA|127177167
996 ‎‡2 ISNI|0000000028987389
996 ‎‡2 NDL|00915682
996 ‎‡2 J9U|987007272601505171
996 ‎‡2 J9U|987007445912605171
996 ‎‡2 BIBSYS|90635023
996 ‎‡2 NYNYRILM|2638
996 ‎‡2 RERO|A022781993
996 ‎‡2 LC|no2002116304
996 ‎‡2 LC|n 50029417
996 ‎‡2 ISNI|0000000054298165
996 ‎‡2 NTA|071281622
996 ‎‡2 NLA|000036016512
996 ‎‡2 ISNI|0000000067107604
996 ‎‡2 LC|n 82200946
996 ‎‡2 CAOONL|ncf10117957
996 ‎‡2 ISNI|0000000117801398
996 ‎‡2 J9U|987007459680305171
996 ‎‡2 BAV|495_292746
996 ‎‡2 LC|n 50034190
996 ‎‡2 PTBNP|857006
996 ‎‡2 ISNI|0000000118047374
996 ‎‡2 LC|n 82232532
996 ‎‡2 LC|no2013119804
996 ‎‡2 LC|n 2017184102
996 ‎‡2 BNC|981058512064306706
996 ‎‡2 BIBSYS|90224753
996 ‎‡2 LC|no2014025424
996 ‎‡2 ISNI|0000000026558644
996 ‎‡2 RERO|A003388735
996 ‎‡2 RERO|A003388733
996 ‎‡2 RERO|A003388731
996 ‎‡2 RERO|A003388730
996 ‎‡2 ISNI|000000011493323X
996 ‎‡2 DNB|1164046055
996 ‎‡2 LC|no2016078215
996 ‎‡2 ISNI|0000000051127184
996 ‎‡2 LC|n 85057147
996 ‎‡2 LC|n 2020057855
996 ‎‡2 NII|DA03697695
996 ‎‡2 SKMASNL|vtls011209069
996 ‎‡2 LC|n 95036563
996 ‎‡2 DNB|17323139X
996 ‎‡2 LC|n 2002103906
996 ‎‡2 LC|no2017003096
996 ‎‡2 ISNI|0000000495600681
996 ‎‡2 LC|n 82229434
996 ‎‡2 DNB|138798400
996 ‎‡2 LC|n 99023082
996 ‎‡2 LC|nb2010004521
996 ‎‡2 BIBSYS|90988751
996 ‎‡2 NDL|00841613
996 ‎‡2 BIBSYS|11024160
996 ‎‡2 LC|n 80019404
996 ‎‡2 LC|n 88041220
996 ‎‡2 NII|DA0384967X
996 ‎‡2 DNB|172147085
996 ‎‡2 ISNI|0000000117497613
996 ‎‡2 J9U|987007314967405171
996 ‎‡2 CAOONL|ncf11332917
996 ‎‡2 LC|n 85387294
996 ‎‡2 ERRR|11548101
996 ‎‡2 SUDOC|09530892X
996 ‎‡2 LC|no2008123200
996 ‎‡2 ISNI|0000000121303076
996 ‎‡2 LC|nr2001010405
996 ‎‡2 N6I|vtls000342535
996 ‎‡2 LC|n 2015018739
996 ‎‡2 ISNI|000000003628427X
996 ‎‡2 BIBSYS|90565480
996 ‎‡2 ISNI|000000008107743X
996 ‎‡2 J9U|987011289091905171
996 ‎‡2 RERO|A011789395
996 ‎‡2 CAOONL|ncf12096294
996 ‎‡2 LC|no2009182663
996 ‎‡2 NDL|00514010
996 ‎‡2 J9U|987007277429005171
996 ‎‡2 ISNI|0000000107516139
996 ‎‡2 N6I|vtls000074107
996 ‎‡2 LC|nb 99068790
996 ‎‡2 SELIBR|295098
996 ‎‡2 LC|n 2001029558
996 ‎‡2 BIBSYS|90172106
996 ‎‡2 ISNI|0000000497424247
996 ‎‡2 LC|no2001081614
996 ‎‡2 LC|no2008148186
996 ‎‡2 J9U|987007422718505171
996 ‎‡2 LC|nr2003035344
996 ‎‡2 BNE|XX4833231
996 ‎‡2 NKC|jo20231187762
996 ‎‡2 NKC|ntk20241231254
996 ‎‡2 LC|n 95048776
996 ‎‡2 LC|n 80014956
996 ‎‡2 NTA|128415282
996 ‎‡2 LC|no2014136657
996 ‎‡2 BIBSYS|99039468
996 ‎‡2 LC|n 90689501
996 ‎‡2 NSK|000713228
996 ‎‡2 BIBSYS|4086445
996 ‎‡2 DNB|1187002127
996 ‎‡2 ISNI|0000000067494712
996 ‎‡2 NTA|183658698
996 ‎‡2 NII|DA02514519
996 ‎‡2 DNB|118707930
996 ‎‡2 CAOONL|ncf10029730
996 ‎‡2 ISNI|0000000084439635
996 ‎‡2 BIBSYS|7015692
996 ‎‡2 LC|nb2005018206
996 ‎‡2 NUKAT|n 2004000382
996 ‎‡2 J9U|987007275031005171
996 ‎‡2 LC|n 80142485
996 ‎‡2 ISNI|0000000019473212
996 ‎‡2 ISNI|0000000385598023
996 ‎‡2 J9U|987007352856305171
996 ‎‡2 RERO|A019188529
996 ‎‡2 BIBSYS|90223872
996 ‎‡2 J9U|987007376330305171
996 ‎‡2 ISNI|0000000064595219
996 ‎‡2 NKC|mub20221156737
996 ‎‡2 ISNI|0000000075494480
996 ‎‡2 PLWABN|9810595162005606
996 ‎‡2 CAOONL|ncf11553910
996 ‎‡2 SUDOC|07594572X
996 ‎‡2 NUKAT|n 2016246835
996 ‎‡2 NTA|150654111
996 ‎‡2 LC|no2012111917
996 ‎‡2 DE633|pe106259
996 ‎‡2 BIBSYS|90693766
996 ‎‡2 LC|no2009151883
996 ‎‡2 ISNI|0000000077243095
996 ‎‡2 N6I|vtls000018890
997 ‎‡a 0 0 lived 0 0‏ ‎‡9 1‏