VIAF

Virtual International Authority File

Search

Leader 00000nz a2200037n 45 0
001 WKP|Q92313349 (VIAF cluster) (Authority/Source Record)
003 WKP
005 20241020233045.0
008 241020nneanz||abbn n and d
035 ‎‡a (WKP)Q92313349‏
024 ‎‡a 0000-0002-8733-5932‏ ‎‡2 orcid‏
035 ‎‡a (OCoLC)Q92313349‏
100 0 ‎‡a Jean-Charles Sanchez‏ ‎‡c researcher (ORCID 0000-0002-8733-5932)‏ ‎‡9 en‏
400 0 ‎‡a Jean-Charles Sanchez‏ ‎‡c onderzoeker‏ ‎‡9 nl‏
670 ‎‡a Author's 3D Cellular Architecture Affects MicroRNA and Protein Cargo of Extracellular Vesicles‏
670 ‎‡a Author's '98 Escherichia coli SWISS-2DPAGE database update.‏
670 ‎‡a Author's A clinical molecular scanner to study human proteome complexity‏
670 ‎‡a Author's A combined CXCL10, CXCL8 and H-FABP panel for the staging of human African trypanosomiasis patients‏
670 ‎‡a Author's A high glucose level is associated with decreased aspirin-mediated acetylation of platelet cyclooxygenase (COX)-1 at serine 529: A pilot study‏
670 ‎‡a Author's A molecular scanner to automate proteomic research and to display proteome images‏
670 ‎‡a Author's A multiparameter panel method for outcome prediction following aneurysmal subarachnoid hemorrhage‏
670 ‎‡a Author's A nonlinear wide-range immobilized pH gradient for two-dimensional electrophoresis and its definition in a relevant pH scale‏
670 ‎‡a Author's A novel strategy using MASCOT Distiller for analysis of cleavable isotope-coded affinity tag data to quantify protein changes in plasma‏
670 ‎‡a Author's A panel of cerebrospinal fluid potential biomarkers for the diagnosis of Alzheimer's disease.‏
670 ‎‡a Author's A potential cerebrospinal fluid and plasmatic marker for the diagnosis of Creutzfeldt-Jakob disease‏
670 ‎‡a Author's A role for Edman degradation in proteome studies‏
670 ‎‡a Author's A two-dimensional electrophoretic study of serum amyloid A and C-reactive protein in infants and children‏
670 ‎‡a Author's Accuracy of C-reactive protein, procalcitonin, serum amyloid A and neopterin for low-dose CT-scan confirmed pneumonia in elderly patients: A prospective cohort study‏
670 ‎‡a Author's Admission Levels of Total Tau and β-Amyloid Isoforms 1-40 and 1-42 in Predicting the Outcome of Mild Traumatic Brain Injury‏
670 ‎‡a Author's Age-related proteome analysis of the mouse brain: a 2-DE study‏
670 ‎‡a Author's An Integrative Multi-Omics Workflow to Address Multifactorial Toxicology Experiments‏
670 ‎‡a Author's Analysis of proteins by direct-scanning infrared-MALDI mass spectrometry after 2D-PAGE separation and electroblotting‏
670 ‎‡a Author's Analysis of Proteomes Using the Molecular Scanner‏
670 ‎‡a Author's Anti-(apolipoprotein A-1) IgGs are associated with high levels of oxidized low-density lipoprotein in acute coronary syndrome‏
670 ‎‡a Author's ApoC-I and ApoC-III as potential plasmatic markers to distinguish between ischemic and hemorrhagic stroke‏
670 ‎‡a Author's Assessing cerebrospinal fluid rhinorrhea: a two-dimensional electrophoresis approach‏
670 ‎‡a Author's Assignment of protein function and discovery of novel nucleolar proteins based on automatic analysis of MEDLINE‏
670 ‎‡a Author's Bioinformatics for protein biomarker panel classification: what is needed to bring biomarker panels into in vitro diagnostics?‏
670 ‎‡a Author's Biomarkers predictive value for early diagnosis of Stroke-Associated Pneumonia‏
670 ‎‡a Author's Biotin production under limiting growth conditions by Agrobacterium/Rhizobium HK4 transformed with a modified Escherichia coli bio operon‏
670 ‎‡a Author's Blood glutathione S-transferase-π as a time indicator of stroke onset‏
670 ‎‡a Author's Brain Extracellular Fluid Protein Changes in Acute Stroke Patients‏
670 ‎‡a Author's Bronchoalveolar lavage fluid protein composition in patients with sarcoidosis and idiopathic pulmonary fibrosis: a two-dimensional electrophoretic study‏
670 ‎‡a Author's Cardiac biomarkers levels predict pulmonary embolism extent on chest computed tomography and prognosis in non-massive pulmonary embolism.‏
670 ‎‡a Author's Cerebral ischemic events in patients with pancreatic cancer‏
670 ‎‡a Author's Cerebral ischemic events in patients with pancreatic cancer: A retrospective cohort study of 17 patients and a literature review‏
670 ‎‡a Author's Cerebrospinal Fluid-Derived Microvesicles From Sleeping Sickness Patients Alter Protein Expression in Human Astrocytes‏
670 ‎‡a Author's Cerebrospinal fluid neopterin as marker of the meningo-encephalitic stage of Trypanosoma brucei gambiense sleeping sickness‏
670 ‎‡a Author's Characterisation of the influences of aspirin-acetylation and glycation on human plasma proteins.‏
670 ‎‡a Author's Characterization of heat shock protein 27 phosphorylation sites in renal cell carcinoma.‏
670 ‎‡a Author's Characterization of the glycated human cerebrospinal fluid proteome‏
670 ‎‡a Author's Characterization of the platelet granule proteome: evidence of the presence of MHC1 in Alpha -granules.‏
670 ‎‡a Author's Colloidal carriers for intravenous drug targeting: plasma protein adsorption patterns on surface-modified latex particles evaluated by two-dimensional polyacrylamide gel electrophoresis‏
670 ‎‡a Author's Combined lipidomic and proteomic analysis of isolated human islets exposed to palmitate reveals time-dependent changes in insulin secretion and lipid metabolism‏
670 ‎‡a Author's Combining H-FABP and GFAP increases the capacity to differentiate between CT-positive and CT-negative patients with mild traumatic brain injury.‏
670 ‎‡a Author's Combining low- and high-energy tandem mass spectra for optimized peptide quantification with isobaric tags‏
670 ‎‡a Author's Comparative analysis of cerebrospinal fluid from the meningo-encephalitic stage of T. b. gambiense and rhodesiense sleeping sickness patients using TMT quantitative proteomics‏
670 ‎‡a Author's Comprehensive proteome analysis by chromatographic protein prefractionation.‏
670 ‎‡a Author's Contribution of proteomics to the molecular analysis of renal cell carcinoma with an emphasis on manganese superoxide dismutase‏
670 ‎‡a Author's Correlation between cardiac biomarkers and right ventricular enlargement on chest CT in non massive pulmonary embolism.‏
670 ‎‡a Author's Correlation of proteomic and transcriptomic profiles of Staphylococcus aureus during the post-exponential phase of growth.‏
670 ‎‡a Author's Current challenges and future applications for protein maps and post-translational vector maps in proteome projects‏
670 ‎‡a Author's Current status of the SWISS-2DPAGE database‏
670 ‎‡a Author's Cystatin C as a potential cerebrospinal fluid marker for the diagnosis of Creutzfeldt-Jakob disease.‏
670 ‎‡a Author's Cysteine-reactive covalent capture tags for enrichment of cysteine-containing peptides‏
670 ‎‡a Author's Cysteine tagging for MS-based proteomics‏
670 ‎‡a Author's Deciphering the human nucleolar proteome‏
670 ‎‡a Author's Detailed peptide characterization using PEPTIDEMASS--a World-Wide-Web-accessible tool.‏
670 ‎‡a Author's Detection of biomarkers of stroke using SELDI-TOF.‏
670 ‎‡a Author's Diagnostic performance of peroxiredoxin 1 to determine time-of-onset of acute cerebral infarction‏
670 ‎‡a Author's Discovery and verification of osteopontin and Beta-2-microglobulin as promising markers for staging human African trypanosomiasis‏
670 ‎‡a Author's E-selectin and vascular cell adhesion molecule-1 as biomarkers of 3-month outcome in cerebrovascular diseases‏
670 ‎‡a Author's Early activation of the fatty acid metabolism pathway by chronic high glucose exposure in rat insulin secretory beta-cells‏
670 ‎‡a Author's Early Levels of Glial Fibrillary Acidic Protein and Neurofilament Light Protein in Predicting the Outcome of Mild Traumatic Brain Injury‏
670 ‎‡a Author's Early measurement of interleukin-10 predicts the absence of CT scan lesions in mild traumatic brain injury.‏
670 ‎‡a Author's EasyProt--an easy-to-use graphical platform for proteomics data analysis‏
670 ‎‡a Author's Editorial‏
670 ‎‡a Author's Effect of high-fat diet on the expression of proteins in muscle, adipose tissues, and liver of C57BL/6 mice‏
670 ‎‡a Author's Effect of rosiglitazone on the differential expression of diabetes-associated proteins in pancreatic islets of C57Bl/6 lep/lep mice‏
670 ‎‡a Author's Effect of rosiglitazone on the differential expression of obesity and insulin resistance associated proteins in lep/lep mice‏
670 ‎‡a Author's Elevation of apolipoprotein E in the CSF of cattle affected by BSE‏
670 ‎‡a Author's Enhanced protein recovery after electrotransfer using square wave alternating voltage.‏
670 ‎‡a Author's Enrichment of N-terminal cysteinyl-peptides by covalent capture‏
670 ‎‡a Author's Evaluation of Antigens for Development of a Serological Test for Human African Trypanosomiasis‏
670 ‎‡a Author's Evaluation of the ability of Bifidobacterium longum to metabolize human intestinal mucus.‏
670 ‎‡a Author's Exploitation of specific properties of trifluoroethanol for extraction and separation of membrane proteins‏
670 ‎‡a Author's Exploring glycopeptide-resistance in Staphylococcus aureus: a combined proteomics and transcriptomics approach for the identification of resistance-related markers.‏
670 ‎‡a Author's Extraction of membrane proteins by differential solubilization for separation using two-dimensional gel electrophoresis‏
670 ‎‡a Author's Fatty acid binding protein as a serum marker for the early diagnosis of stroke: a pilot study‏
670 ‎‡a Author's Federated two-dimensional electrophoresis database: a simple means of publishing two-dimensional electrophoresis data‏
670 ‎‡a Author's Fractalkine (CX3CL1), a new factor protecting β-cells against TNFα‏
670 ‎‡a Author's From brain to blood: New biomarkers for ischemic stroke prognosis‏
670 ‎‡a Author's From proteins to proteomes: large scale protein identification by two-dimensional electrophoresis and amino acid analysis‏
670 ‎‡a Author's From relative to absolute quantification of tryptic peptides with tandem mass tags: application to cerebrospinal fluid‏
670 ‎‡a Author's Functional proteomic analysis of human nucleolus‏
670 ‎‡a Author's General statistical modeling of data from protein relative expression isobaric tags.‏
670 ‎‡a Author's Glucotoxicity and pancreatic proteomics‏
670 ‎‡a Author's Glycation isotopic labeling with 13C-reducing sugars for quantitative analysis of glycated proteins in human plasma‏
670 ‎‡a Author's Gold coating of non-conductive membranes before matrix-assisted laser desorption/ionization tandem mass spectrometric analysis prevents charging effect‏
670 ‎‡a Author's H-FABP: A new biomarker to differentiate between CT-positive and CT-negative patients with mild traumatic brain injury.‏
670 ‎‡a Author's Heart-fatty acid-binding protein as a marker for early detection of acute myocardial infarction and stroke.‏
670 ‎‡a Author's High-throughput mass spectrometric discovery of protein post-translational modifications.‏
670 ‎‡a Author's Highlights of the Biology and Disease-driven Human Proteome Project, 2015-2016.‏
670 ‎‡a Author's HSV-1 Cgal+ infection promotes quaking RNA binding protein production and induces nuclear-cytoplasmic shuttling of quaking I-5 isoform in human hepatoma cells‏
670 ‎‡a Author's Human blood platelet protein map established by two-dimensional polyacrylamide gel electrophoresis‏
670 ‎‡a Author's Human gingival crevicular fluid contains MRP8 (S100A8) and MRP14 (S100A9), two calcium-binding proteins of the S100 family‏
670 ‎‡a Author's Human hemolysate glycated proteome‏
670 ‎‡a Author's Human liver protein map: a reference database established by microsequencing and gel comparison‏
670 ‎‡a Author's Human liver protein map: Update 1993‏
670 ‎‡a Author's Human Proteinpedia enables sharing of human protein data‏
670 ‎‡a Author's Human sweat metabolomics for lung cancer screening‏
670 ‎‡a Author's HUPO Brain Proteome Project: summary of the pilot phase and introduction of a comprehensive data reprocessing strategy‏
670 ‎‡a Author's Hydrogen/deuterium exchange for higher specificity of protein identification by peptide mass fingerprinting‏
670 ‎‡a Author's Identification of brain cell death associated proteins in human post-mortem cerebrospinal fluid‏
670 ‎‡a Author's Identification of human, rat and chicken ribosomal proteins by a combination of two-dimensional polyacrylamide gel electrophoresis and mass spectrometry‏
670 ‎‡a Author's Identification of post-mortem cerebrospinal fluid proteins as potential biomarkers of ischemia and neurodegeneration.‏
670 ‎‡a Author's Identification of proteins by their amino acid composition: an evaluation of the method.‏
670 ‎‡a Author's Identification of ribosome-associated viral and cellular basic proteins during the course of infection with herpes simplex virus type 1.‏
670 ‎‡a Author's Identification of specific proteins in different lymphocyte populations by proteomic tools‏
670 ‎‡a Author's IgM are associated to Sp Alpha (CD5 antigen-like)‏
670 ‎‡a Author's Improved and simplified in-gel sample application using reswelling of dry immobilized pH gradients‏
670 ‎‡a Author's Improved characterization of the insulin secretory granule proteomes‏
670 ‎‡a Author's Improving protein identification from peptide mass fingerprinting through a parameterized multi-level scoring algorithm and an optimized peak detection‏
670 ‎‡a Author's Improving the detection of proteins after transfer to polyvinylidene difluoride membranes‏
670 ‎‡a Author's In-gel sample rehydration of immobilized pH gradient‏
670 ‎‡a Author's Information transfer between large and small two-dimensional polyacrylamide gel electrophoresis‏
670 ‎‡a Author's Inhibition of insulin secretion by betagranin, an N-terminal chromogranin A fragment‏
670 ‎‡a Author's Inside SWISS-2DPAGE database‏
670 ‎‡a Author's Integrating two-dimensional gel databases using the Melanie II software.‏
670 ‎‡a Author's Interleukin 10 and Heart Fatty Acid-Binding Protein as Early Outcome Predictors in Patients With Traumatic Brain Injury‏
670 ‎‡a Author's Intracellular and Extracellular Markers of Lethality in Osteogenesis Imperfecta: A Quantitative Proteomic Approach‏
670 ‎‡a Author's ISG20L2, a novel vertebrate nucleolar exoribonuclease involved in ribosome biogenesis‏
670 ‎‡a Author's Isobaric tagging-based selection and quantitation of cerebrospinal fluid tryptic peptides with reporter calibration curves‏
670 ‎‡a Author's Isolation of nucleoli‏
670 ‎‡a Author's Labeling of Bifidobacterium longum cells with 13C-substituted leucine for quantitative proteomic analyses‏
670 ‎‡a Author's Large-scale amino-acid analysis for proteome studies‏
670 ‎‡a Author's Large-scale protein modelling and integration with the SWISS-PROT and SWISS-2DPAGE databases: the example of Escherichia coli.‏
670 ‎‡a Author's Make2ddb: a simple package to set up a two-dimensional electrophoresis database for the World Wide Web.‏
670 ‎‡a Author's Matrix-assisted laser desorption/ionization-tandem mass spectrometry with high resolution and sensitivity for identification and characterization of proteins‏
670 ‎‡a Author's Matrix metalloproteinase 9 and cellular fibronectin plasma concentrations are predictors of the composite endpoint of length of stay and death in the intensive care unit after severe traumatic brain injury‏
670 ‎‡a Author's Matrix metalloproteinase-9 and intercellular adhesion molecule 1 are powerful staging markers for human African trypanosomiasis‏
670 ‎‡a Author's Measuring Serum Amyloid A for Infection Prediction in Aneurysmal Subarachnoid Hemorrhage‏
670 ‎‡a Author's Mechanisms of local invasion in enteroendocrine tumors: identification of novel candidate cytoskeleton-associated proteins in an experimental mouse model by a proteomic approach and validation in human tumors.‏
670 ‎‡a Author's Melanie II--a third-generation software package for analysis of two-dimensional electrophoresis images: I. Features and user interface.‏
670 ‎‡a Author's Method for identification and quantitative analysis of protein lysine methylation using matrix-assisted laser desorption/ionization — time-of-flight mass spectrometry and amino acid analysis‏
670 ‎‡a Author's Micropreparative two-dimensional electrophoresis allowing the separation of samples containing milligram amounts of proteins‏
670 ‎‡a Author's Mining mass spectra for diagnosis and biomarker discovery of cerebral accidents‏
670 ‎‡a Author's Modified expression of plasma glutathione peroxidase and manganese superoxide dismutase in human renal cell carcinoma‏
670 ‎‡a Author's Modified immobilized pH gradient gel strip equilibration procedure in SWISS-2DPAGE protocols‏
670 ‎‡a Author's Modulation of neuronal pentraxin 1 expression in rat pancreatic β-cells submitted to chronic glucotoxic stress‏
670 ‎‡a Author's MSight: an image analysis software for liquid chromatography-mass spectrometry‏
670 ‎‡a Author's Multi-dimensional HPLC/MS of the nucleolar proteome using HPLC-chip/MS.‏
670 ‎‡a Author's Multilevel omics for the discovery of biomarkers and therapeutic targets for stroke‏
670 ‎‡a Author's Multiple parameter cross-species protein identification using MultiIdent--a world-wide web accessible tool.‏
670 ‎‡a Author's N-t-butyliodoacetamide and iodoacetanilide: two new cysteine alkylating reagents for relative quantitation of proteins‏
670 ‎‡a Author's Neopterin and CXCL-13 in Diagnosis and Follow-Up of Trypanosoma brucei gambiense Sleeping Sickness: Lessons from the Field in Angola‏
670 ‎‡a Author's Neopterin is a cerebrospinal fluid marker for treatment outcome evaluation in patients affected by Trypanosoma brucei gambiense sleeping sickness‏
670 ‎‡a Author's Neopterin plasma concentrations in patients with aneurysmal subarachnoid hemorrhage: correlation with infection and long-term outcome.‏
670 ‎‡a Author's New biomarkers for stage determination in Trypanosoma brucei rhodesiense sleeping sickness patients‏
670 ‎‡a Author's New molecular insights into modulation of platelet reactivity in aspirin-treated patients using a network-based approach‏
670 ‎‡a Author's New perspectives in the Escherichia coli proteome investigation‏
670 ‎‡a Author's Nonredundant mass spectrometry: a strategy to integrate mass spectrometry acquisition and analysis‏
670 ‎‡a Author's Nucleolin interacts with US11 protein of herpes simplex virus 1 and is involved in its trafficking‏
670 ‎‡a Author's Palmitate-Induced Insulin Hypersecretion and Later Secretory Decline Associated with Changes in Protein Expression Patterns in Human Pancreatic Islets‏
670 ‎‡a Author's PanelomiX: A threshold-based algorithm to create panels of biomarkers‏
670 ‎‡a Author's PARK7 and nucleoside diphosphate kinase A as plasma markers for the early diagnosis of stroke‏
670 ‎‡a Author's Phenotyping of apolipoprotein E using immobilized pH gradient gels for one-dimensional and two-dimensional separations‏
670 ‎‡a Author's Plasma and red blood cell protein maps: update 1993‏
670 ‎‡a Author's Plasma protein map: an update by microsequencing‏
670 ‎‡a Author's Platelet proteomics‏
670 ‎‡a Author's Platelet reactivity is a stable and global phenomenon in aspirin-treated cardiovascular patients‏
670 ‎‡a Author's pROC: an open-source package for R and S+ to analyze and compare ROC curves‏
670 ‎‡a Author's Profiling the proteomic inflammatory state of human astrocytes using DIA mass spectrometry‏
670 ‎‡a Author's Progress with proteome projects: why all proteins expressed by a genome should be identified and how to do it.‏
670 ‎‡a Author's Prostaglandin D2 synthase and its post-translational modifications in neurological disorders‏
670 ‎‡a Author's Protein identification and analysis tools in the ExPASy server‏
670 ‎‡a Author's Protein identification with N and C-terminal sequence tags in proteome projects‏
670 ‎‡a Author's Protein identification with sequence tags.‏
670 ‎‡a Author's Protein pathway analysis to study development-dependent effects of acute and repeated trimethyltin (TMT) treatments in 3D rat brain cell cultures‏
670 ‎‡a Author's Proteome Analysis‏
670 ‎‡a Author's Proteomic analysis of a podocyte vesicle-enriched fraction from human normal and pathological urine samples‏
670 ‎‡a Author's Proteomic analysis of human substantia nigra identifies novel candidates involved in Parkinson's disease pathogenesis‏
670 ‎‡a Author's Proteomic discovery and verification of serum amyloid A as a predictor marker of patients at risk of post-stroke infection: a pilot study‏
670 ‎‡a Author's Proteomic profiling of the substantia nigra demonstrates CNDP2 overexpression in Parkinson's disease‏
670 ‎‡a Author's Proteomics analysis of insulin secretory granules.‏
670 ‎‡a Author's Proteomics and its trends facing nature's complexity.‏
670 ‎‡a Author's Proteomics application exercise of the Swiss Proteomics Society: Report of the SPS'02 session‏
670 ‎‡a Author's Proteomics meets cell biology: the establishment of subcellular proteomes‏
670 ‎‡a Author's Proteomics of regulated secretory organelles‏
670 ‎‡a Author's Qualitative and quantitative analysis of glycated proteins in human plasma by glucose isotopic labeling with ¹³C6-reducing sugars.‏
670 ‎‡a Author's Quantitative analysis of glycated proteins‏
670 ‎‡a Author's Quantitative Analysis of Human Cerebrospinal Fluid Proteins Using a Combination of Cysteine Tagging and Amine-Reactive Isobaric Labeling‏
670 ‎‡a Author's Quantitative proteomics reveals the link between minichromosome maintenance complex and glucose-induced proliferation of rat pancreatic INS-1E β-cells‏
670 ‎‡a Author's Rapid protein identification using N-terminal "sequence tag" and amino acid analysis‏
670 ‎‡a Author's Relative protein quantification by MS/MS using the tandem mass tag technology‏
670 ‎‡a Author's Relative quantification of proteins in human cerebrospinal fluids by MS/MS using 6-plex isobaric tags‏
670 ‎‡a Author's Renal cell carcinoma and normal kidney protein expression‏
670 ‎‡a Author's SAA (Serum Amyloid A): A Novel Predictor of Stroke-Associated Infections‏
670 ‎‡a Author's Sharing of worldwide spread knowledge using hypermedia facilities & fast communication protocols‏
670 ‎‡a Author's Sharing of worldwide spread knowledge using hypermedia facilities & fast communication protocols (Mosaic and World Wide Web): the example of ExPASy‏
670 ‎‡a Author's Shotgun proteomics data on the impact of hyperglycaemia on platelet protein acetylation by aspirin‏
670 ‎‡a Author's Simultaneous analysis of cyclin and oncogene expression using multiple monoclonal antibody immunoblots‏
670 ‎‡a Author's Single Cell Immuno-Laser Microdissection Coupled to Label-Free Proteomics to Reveal the Proteotypes of Human Brain Cells After Ischemia.‏
670 ‎‡a Author's Sleeping Sickness in the 'Omics Era.‏
670 ‎‡a Author's Specific sample preparation in colorectal cancer‏
670 ‎‡a Author's Spermatocytes and round spermatids of rat testis: protein patterns‏
670 ‎‡a Author's Spermatocytes and round spermatids of rat testis: the difference between in vivo and in vitro protein patterns‏
670 ‎‡a Author's SPS' Digest: The Swiss Proteomics Society selection of proteomics articles‏
670 ‎‡a Author's Standardized characterization of gene expression in human colorectal epithelium by two-dimensional electrophoresis‏
670 ‎‡a Author's STAT6 promotes bi-directional modulation of PKM2 in liver and adipose inflammatory cells in rosiglitazone-treated mice‏
670 ‎‡a Author's State-of-the-art two-dimensional gel electrophoresis: a key tool of proteomics research‏
670 ‎‡a Author's Studies of quantitative analysis of protein expression in Saccharomyces cerevisiae‏
670 ‎‡a Author's SWISS-2DPAGE: a database of two-dimensional gel electrophoresis images‏
670 ‎‡a Author's SWISS-2DPAGE, ten years later‏
670 ‎‡a Author's The 1999 SWISS-2DPAGE database update‏
670 ‎‡a Author's The 9th Siena Meeting - from genome to proteome: open innovations‏
670 ‎‡a Author's The cell-envelope proteome of Bifidobacterium longum in an in vitro bile environment‏
670 ‎‡a Author's The dynamic range of protein expression: a challenge for proteomic research‏
670 ‎‡a Author's The establishment of a human liver nuclei two-dimensional electrophoresis reference map‏
670 ‎‡a Author's The focusing positions of polypeptides in immobilized pH gradients can be predicted from their amino acid sequences‏
670 ‎‡a Author's The magic of words‏
670 ‎‡a Author's The molecular scanner: concept and developments‏
670 ‎‡a Author's The mouse SWISS-2D PAGE database: a tool for proteomics study of diabetes and obesity‏
670 ‎‡a Author's The prognostic significance of the serum biomarker heart-fatty acidic binding protein in comparison with s100b in severe traumatic brain injury.‏
670 ‎‡a Author's The SWISS-2DPAGE database of two-dimensional polyacrylamide gel electrophoresis.‏
670 ‎‡a Author's The SWISS-2DPAGE database of two-dimensional polyacrylamide gel electrophoresis, its status in 1995.‏
670 ‎‡a Author's The SWISS-2DPAGE database: what has changed during the last year‏
670 ‎‡a Author's The translationally controlled tumor protein is a novel calcium binding protein of the human placenta and regulates calcium handling in trophoblast cells‏
670 ‎‡a Author's The yeast SWISS-2DPAGE database‏
670 ‎‡a Author's Toward a Clinical Molecular Scanner for Proteome Research: Parallel Protein Chemical Processing before and during Western Blot‏
670 ‎‡a Author's Towards an automated approach for protein identification in proteome projects‏
670 ‎‡a Author's Translational proteomics‏
670 ‎‡a Author's Translationally controlled tumor protein: a protein identified in several nontumoral cells including erythrocytes‏
670 ‎‡a Author's Translationally controlled tumor protein (TCTP) in the human prostate and prostate cancer cells: expression, distribution, and calcium binding activity‏
670 ‎‡a Author's Translationally controlled tumour protein (TCTP) is present in human cornea and increases in herpetic keratitis.‏
670 ‎‡a Author's Truncated cystatin C in cerebrospiral fluid: Technical [corrected] artefact or biological process?‏
670 ‎‡a Author's Two-dimensional electrophoresis resources available from ExPASy‏
670 ‎‡a Author's Two-dimensional gel electrophoresis for proteome projects: the effects of protein hydrophobicity and copy number‏
670 ‎‡a Author's Two-dimensional gel electrophoresis ofEscherichia coli homogenates: TheEscherichia coli SWISS-2DPAGE database‏
670 ‎‡a Author's Two-dimensional polyacrylamide gel electrophoresis isolation and microsequencing of Pseudomonas aeruginosa proteins‏
670 ‎‡a Author's Ubiquinone Metabolism and Transcription HIF-1 Targets Pathway Are Toxicity Signature Pathways Present in Extracellular Vesicles of Paraquat-Exposed Human Brain Microvascular Endothelial Cells‏
670 ‎‡a Author's Ubiquitin fusion degradation protein 1 as a blood marker for the early diagnosis of ischemic stroke‏
909 ‎‡a (orcid) 0000000287335932‏ ‎‡9 1‏
912 ‎‡a humanproteinpediaenablessharingofhumanproteindata‏ ‎‡A Human Proteinpedia enables sharing of human protein data‏ ‎‡9 1‏
912 ‎‡a editorial‏ ‎‡A Editorial‏ ‎‡9 1‏
919 ‎‡a humansweatmetabolomicsforlungcancerscreening‏ ‎‡A Human sweat metabolomics for lung cancer screening‏ ‎‡9 1‏
919 ‎‡a hupobrainproteomeprojectsummaryofthepilotphaseandintroductionofacomprehensivedatareprocessingstrategy‏ ‎‡A HUPO Brain Proteome Project: summary of the pilot phase and introduction of a comprehensive data reprocessing strategy‏ ‎‡9 1‏
919 ‎‡a ubiquitinfusiondegradationprotein1asabloodmarkerfortheearlydiagnosisofischemicstroke‏ ‎‡A Ubiquitin fusion degradation protein 1 as a blood marker for the early diagnosis of ischemic stroke‏ ‎‡9 1‏
919 ‎‡a ubiquinonemetabolismandtranscriptionhif1targetspathwayaretoxicitysignaturepathwayspresentinextracellularvesiclesofparaquatexposedhumanbrainmicrovascularendothelialcells‏ ‎‡A Ubiquinone Metabolism and Transcription HIF-1 Targets Pathway Are Toxicity Signature Pathways Present in Extracellular Vesicles of Paraquat-Exposed Human Brain Microvascular Endothelial Cells‏ ‎‡9 1‏
919 ‎‡a 2dimensionalpolyacrylamidegelelectrophoresisisolationandmicrosequencingofpseudomonasaeruginosaproteins‏ ‎‡A Two-dimensional polyacrylamide gel electrophoresis isolation and microsequencing of Pseudomonas aeruginosa proteins‏ ‎‡9 1‏
919 ‎‡a 2dimensionalgelelectrophoresisofescherichiacolihomogenatestheescherichiacoliswiss2dpagedatabase‏ ‎‡A Two-dimensional gel electrophoresis ofEscherichia coli homogenates: TheEscherichia coli SWISS-2DPAGE database‏ ‎‡9 1‏
919 ‎‡a 2dimensionalgelelectrophoresisforproteomeprojectstheeffectsofproteinhydrophobicityandcopynumber‏ ‎‡A Two-dimensional gel electrophoresis for proteome projects: the effects of protein hydrophobicity and copy number‏ ‎‡9 1‏
919 ‎‡a 2dimensionalelectrophoresisresourcesavailablefromexpasy‏ ‎‡A Two-dimensional electrophoresis resources available from ExPASy‏ ‎‡9 1‏
919 ‎‡a truncatedcystatin100incerebrospiralfluidtechnicalartefactorbiologicalprocess‏ ‎‡A Truncated cystatin C in cerebrospiral fluid: Technical [corrected] artefact or biological process?‏ ‎‡9 1‏
919 ‎‡a translationallycontrolledtumourproteintctpispresentinhumancorneaandincreasesinherpetickeratitis‏ ‎‡A Translationally controlled tumour protein (TCTP) is present in human cornea and increases in herpetic keratitis.‏ ‎‡9 1‏
919 ‎‡a translationallycontrolledtumorproteintctpinthehumanprostateandprostatecancercellsexpressiondistributionandcalciumbindingactivity‏ ‎‡A Translationally controlled tumor protein (TCTP) in the human prostate and prostate cancer cells: expression, distribution, and calcium binding activity‏ ‎‡9 1‏
919 ‎‡a translationallycontrolledtumorproteinaproteinidentifiedinseveralnontumoralcellsincludingerythrocytes‏ ‎‡A Translationally controlled tumor protein: a protein identified in several nontumoral cells including erythrocytes‏ ‎‡9 1‏
919 ‎‡a translationalproteomics‏ ‎‡A Translational proteomics‏ ‎‡9 1‏
919 ‎‡a towardsanautomatedapproachforproteinidentificationinproteomeprojects‏ ‎‡A Towards an automated approach for protein identification in proteome projects‏ ‎‡9 1‏
919 ‎‡a towardaclinicalmolecularscannerforproteomeresearchparallelproteinchemicalprocessingbeforeandduringwesternblot‏ ‎‡A Toward a Clinical Molecular Scanner for Proteome Research: Parallel Protein Chemical Processing before and during Western Blot‏ ‎‡9 1‏
919 ‎‡a yeastswiss2dpagedatabase‏ ‎‡A The yeast SWISS-2DPAGE database‏ ‎‡9 1‏
919 ‎‡a translationallycontrolledtumorproteinisanovelcalciumbindingproteinofthehumanplacentaandregulatescalciumhandlingintrophoblastcells‏ ‎‡A The translationally controlled tumor protein is a novel calcium binding protein of the human placenta and regulates calcium handling in trophoblast cells‏ ‎‡9 1‏
919 ‎‡a swiss2dpagedatabasewhathaschangedduringthelastyear‏ ‎‡A The SWISS-2DPAGE database: what has changed during the last year‏ ‎‡9 1‏
919 ‎‡a swiss2dpagedatabaseof2dimensionalpolyacrylamidegelelectrophoresisitsstatusin‏ ‎‡A The SWISS-2DPAGE database of two-dimensional polyacrylamide gel electrophoresis, its status in 1995.‏ ‎‡9 1‏
919 ‎‡a swiss2dpagedatabaseof2dimensionalpolyacrylamidegelelectrophoresis‏ ‎‡A The SWISS-2DPAGE database of two-dimensional polyacrylamide gel electrophoresis.‏ ‎‡9 1‏
919 ‎‡a prognosticsignificanceoftheserumbiomarkerheartfattyacidicbindingproteinincomparisonwiths100binseveretraumaticbraininjury‏ ‎‡A The prognostic significance of the serum biomarker heart-fatty acidic binding protein in comparison with s100b in severe traumatic brain injury.‏ ‎‡9 1‏
919 ‎‡a mouseswiss2dpagedatabaseatoolforproteomicsstudyofdiabetesandobesity‏ ‎‡A The mouse SWISS-2D PAGE database: a tool for proteomics study of diabetes and obesity‏ ‎‡9 1‏
919 ‎‡a molecularscannerconceptanddevelopments‏ ‎‡A The molecular scanner: concept and developments‏ ‎‡9 1‏
919 ‎‡a magicofwords‏ ‎‡A The magic of words‏ ‎‡9 1‏
919 ‎‡a focusingpositionsofpolypeptidesinimmobilizedphgradientscanbepredictedfromtheiraminoacidsequences‏ ‎‡A The focusing positions of polypeptides in immobilized pH gradients can be predicted from their amino acid sequences‏ ‎‡9 1‏
919 ‎‡a establishmentofahumanlivernuclei2dimensionalelectrophoresisreferencemap‏ ‎‡A The establishment of a human liver nuclei two-dimensional electrophoresis reference map‏ ‎‡9 1‏
919 ‎‡a dynamicrangeofproteinexpressionachallengeforproteomicresearch‏ ‎‡A The dynamic range of protein expression: a challenge for proteomic research‏ ‎‡9 1‏
919 ‎‡a cellenvelopeproteomeofbifidobacteriumlonguminaninvitrobileenvironment‏ ‎‡A The cell-envelope proteome of Bifidobacterium longum in an in vitro bile environment‏ ‎‡9 1‏
919 ‎‡a 9sienameetingfromgenometoproteomeopeninnovations‏ ‎‡A The 9th Siena Meeting - from genome to proteome: open innovations‏ ‎‡9 1‏
919 ‎‡a 1999swiss2dpagedatabaseupdate‏ ‎‡A The 1999 SWISS-2DPAGE database update‏ ‎‡9 1‏
919 ‎‡a swiss2dpage10yearslater‏ ‎‡A SWISS-2DPAGE, ten years later‏ ‎‡9 1‏
919 ‎‡a swiss2dpageadatabaseof2dimensionalgelelectrophoresisimages‏ ‎‡A SWISS-2DPAGE: a database of two-dimensional gel electrophoresis images‏ ‎‡9 1‏
919 ‎‡a studiesofquantitativeanalysisofproteinexpressioninsaccharomycescerevisiae‏ ‎‡A Studies of quantitative analysis of protein expression in Saccharomyces cerevisiae‏ ‎‡9 1‏
919 ‎‡a stateoftheart2dimensionalgelelectrophoresisakeytoolofproteomicsresearch‏ ‎‡A State-of-the-art two-dimensional gel electrophoresis: a key tool of proteomics research‏ ‎‡9 1‏
919 ‎‡a stat6promotesbidirectionalmodulationofpkm2inliverandadiposeinflammatorycellsinrosiglitazonetreatedmice‏ ‎‡A STAT6 promotes bi-directional modulation of PKM2 in liver and adipose inflammatory cells in rosiglitazone-treated mice‏ ‎‡9 1‏
919 ‎‡a standardizedcharacterizationofgeneexpressioninhumancolorectalepitheliumby2dimensionalelectrophoresis‏ ‎‡A Standardized characterization of gene expression in human colorectal epithelium by two-dimensional electrophoresis‏ ‎‡9 1‏
919 ‎‡a spsdigesttheswissproteomicssocietyselectionofproteomicsarticles‏ ‎‡A SPS' Digest: The Swiss Proteomics Society selection of proteomics articles‏ ‎‡9 1‏
919 ‎‡a spermatocytesandroundspermatidsofrattestisthedifferencebetweeninvivoandinvitroproteinpatterns‏ ‎‡A Spermatocytes and round spermatids of rat testis: the difference between in vivo and in vitro protein patterns‏ ‎‡9 1‏
919 ‎‡a spermatocytesandroundspermatidsofrattestisproteinpatterns‏ ‎‡A Spermatocytes and round spermatids of rat testis: protein patterns‏ ‎‡9 1‏
919 ‎‡a specificsamplepreparationincolorectalcancer‏ ‎‡A Specific sample preparation in colorectal cancer‏ ‎‡9 1‏
919 ‎‡a sleepingsicknessintheomicsera‏ ‎‡A Sleeping Sickness in the 'Omics Era.‏ ‎‡9 1‏
919 ‎‡a singlecellimmunolasermicrodissectioncoupledtolabelfreeproteomicstorevealtheproteotypesofhumanbraincellsafterischemia‏ ‎‡A Single Cell Immuno-Laser Microdissection Coupled to Label-Free Proteomics to Reveal the Proteotypes of Human Brain Cells After Ischemia.‏ ‎‡9 1‏
919 ‎‡a simultaneousanalysisofcyclinandoncogeneexpressionusingmultiplemonoclonalantibodyimmunoblots‏ ‎‡A Simultaneous analysis of cyclin and oncogene expression using multiple monoclonal antibody immunoblots‏ ‎‡9 1‏
919 ‎‡a shotgunproteomicsdataontheimpactofhyperglycaemiaonplateletproteinacetylationbyaspirin‏ ‎‡A Shotgun proteomics data on the impact of hyperglycaemia on platelet protein acetylation by aspirin‏ ‎‡9 1‏
919 ‎‡a sharingofworldwidespreadknowledgeusinghypermediafacilitiesandfastcommunicationprotocolsmosaicandworldwidewebtheexampleofexpasy‏ ‎‡A Sharing of worldwide spread knowledge using hypermedia facilities & fast communication protocols (Mosaic and World Wide Web): the example of ExPASy‏ ‎‡9 1‏
919 ‎‡a sharingofworldwidespreadknowledgeusinghypermediafacilitiesandfastcommunicationprotocols‏ ‎‡A Sharing of worldwide spread knowledge using hypermedia facilities & fast communication protocols‏ ‎‡9 1‏
919 ‎‡a saaserumamyloidaanovelpredictorofstrokeassociatedinfections‏ ‎‡A SAA (Serum Amyloid A): A Novel Predictor of Stroke-Associated Infections‏ ‎‡9 1‏
919 ‎‡a renalcellcarcinomaandnormalkidneyproteinexpression‏ ‎‡A Renal cell carcinoma and normal kidney protein expression‏ ‎‡9 1‏
919 ‎‡a relativequantificationofproteinsinhumancerebrospinalfluidsbymsmsusing6plexisobarictags‏ ‎‡A Relative quantification of proteins in human cerebrospinal fluids by MS/MS using 6-plex isobaric tags‏ ‎‡9 1‏
919 ‎‡a relativeproteinquantificationbymsmsusingthetandemmasstagtechnology‏ ‎‡A Relative protein quantification by MS/MS using the tandem mass tag technology‏ ‎‡9 1‏
919 ‎‡a rapidproteinidentificationusingnterminalsequencetagandaminoacidanalysis‏ ‎‡A Rapid protein identification using N-terminal "sequence tag" and amino acid analysis‏ ‎‡9 1‏
919 ‎‡a quantitativeproteomicsrevealsthelinkbetweenminichromosomemaintenancecomplexandglucoseinducedproliferationofratpancreaticins1eβcells‏ ‎‡A Quantitative proteomics reveals the link between minichromosome maintenance complex and glucose-induced proliferation of rat pancreatic INS-1E β-cells‏ ‎‡9 1‏
919 ‎‡a quantitativeanalysisofhumancerebrospinalfluidproteinsusingacombinationofcysteinetaggingandaminereactiveisobariclabeling‏ ‎‡A Quantitative Analysis of Human Cerebrospinal Fluid Proteins Using a Combination of Cysteine Tagging and Amine-Reactive Isobaric Labeling‏ ‎‡9 1‏
919 ‎‡a quantitativeanalysisofglycatedproteins‏ ‎‡A Quantitative analysis of glycated proteins‏ ‎‡9 1‏
919 ‎‡a qualitativeandquantitativeanalysisofglycatedproteinsinhumanplasmabyglucoseisotopiclabelingwith13c6reducingsugars‏ ‎‡A Qualitative and quantitative analysis of glycated proteins in human plasma by glucose isotopic labeling with ¹³C6-reducing sugars.‏ ‎‡9 1‏
919 ‎‡a proteomicsofregulatedsecretoryorganelles‏ ‎‡A Proteomics of regulated secretory organelles‏ ‎‡9 1‏
919 ‎‡a proteomicsmeetscellbiologytheestablishmentofsubcellularproteomes‏ ‎‡A Proteomics meets cell biology: the establishment of subcellular proteomes‏ ‎‡9 1‏
919 ‎‡a proteomicsapplicationexerciseoftheswissproteomicssocietyreportofthesps02session‏ ‎‡A Proteomics application exercise of the Swiss Proteomics Society: Report of the SPS'02 session‏ ‎‡9 1‏
919 ‎‡a proteomicsanditstrendsfacingnaturescomplexity‏ ‎‡A Proteomics and its trends facing nature's complexity.‏ ‎‡9 1‏
919 ‎‡a proteomicsanalysisofinsulinsecretorygranules‏ ‎‡A Proteomics analysis of insulin secretory granules.‏ ‎‡9 1‏
919 ‎‡a proteomicprofilingofthesubstantianigrademonstratescndp2overexpressioninparkinsonsdisease‏ ‎‡A Proteomic profiling of the substantia nigra demonstrates CNDP2 overexpression in Parkinson's disease‏ ‎‡9 1‏
919 ‎‡a proteomicdiscoveryandverificationofserumamyloidaasapredictormarkerofpatientsatriskofpoststrokeinfectionapilotstudy‏ ‎‡A Proteomic discovery and verification of serum amyloid A as a predictor marker of patients at risk of post-stroke infection: a pilot study‏ ‎‡9 1‏
919 ‎‡a proteomicanalysisofhumansubstantianigraidentifiesnovelcandidatesinvolvedinparkinsonsdiseasepathogenesis‏ ‎‡A Proteomic analysis of human substantia nigra identifies novel candidates involved in Parkinson's disease pathogenesis‏ ‎‡9 1‏
919 ‎‡a proteomicanalysisofapodocytevesicleenrichedfractionfromhumannormalandpathologicalurinesamples‏ ‎‡A Proteomic analysis of a podocyte vesicle-enriched fraction from human normal and pathological urine samples‏ ‎‡9 1‏
919 ‎‡a proteomeanalysis‏ ‎‡A Proteome Analysis‏ ‎‡9 1‏
919 ‎‡a proteinpathwayanalysistostudydevelopmentdependenteffectsofacuteandrepeatedtrimethyltintmttreatmentsin3dratbraincellcultures‏ ‎‡A Protein pathway analysis to study development-dependent effects of acute and repeated trimethyltin (TMT) treatments in 3D rat brain cell cultures‏ ‎‡9 1‏
919 ‎‡a proteinidentificationwithsequencetags‏ ‎‡A Protein identification with sequence tags.‏ ‎‡9 1‏
919 ‎‡a proteinidentificationwithnand100terminalsequencetagsinproteomeprojects‏ ‎‡A Protein identification with N and C-terminal sequence tags in proteome projects‏ ‎‡9 1‏
919 ‎‡a proteinidentificationandanalysistoolsintheexpasyserver‏ ‎‡A Protein identification and analysis tools in the ExPASy server‏ ‎‡9 1‏
919 ‎‡a prostaglandind2synthaseanditsposttranslationalmodificationsinneurologicaldisorders‏ ‎‡A Prostaglandin D2 synthase and its post-translational modifications in neurological disorders‏ ‎‡9 1‏
919 ‎‡a progresswithproteomeprojectswhyallproteinsexpressedbyagenomeshouldbeidentifiedandhowtodoit‏ ‎‡A Progress with proteome projects: why all proteins expressed by a genome should be identified and how to do it.‏ ‎‡9 1‏
919 ‎‡a profilingtheproteomicinflammatorystateofhumanastrocytesusingdiamassspectrometry‏ ‎‡A Profiling the proteomic inflammatory state of human astrocytes using DIA mass spectrometry‏ ‎‡9 1‏
919 ‎‡a procanopensourcepackageforrands+toanalyzeandcompareroccurves‏ ‎‡A pROC: an open-source package for R and S+ to analyze and compare ROC curves‏ ‎‡9 1‏
919 ‎‡a plateletreactivityisastableandglobalphenomenoninaspirintreatedcardiovascularpatients‏ ‎‡A Platelet reactivity is a stable and global phenomenon in aspirin-treated cardiovascular patients‏ ‎‡9 1‏
919 ‎‡a plateletproteomics‏ ‎‡A Platelet proteomics‏ ‎‡9 1‏
919 ‎‡a plasmaproteinmapanupdatebymicrosequencing‏ ‎‡A Plasma protein map: an update by microsequencing‏ ‎‡9 1‏
919 ‎‡a plasmaandredbloodcellproteinmapsupdate‏ ‎‡A Plasma and red blood cell protein maps: update 1993‏ ‎‡9 1‏
919 ‎‡a phenotypingofapolipoproteineusingimmobilizedphgradientgelsfor1dimensionaland2dimensionalseparations‏ ‎‡A Phenotyping of apolipoprotein E using immobilized pH gradient gels for one-dimensional and two-dimensional separations‏ ‎‡9 1‏
919 ‎‡a park7andnucleosidediphosphatekinaseaasplasmamarkersfortheearlydiagnosisofstroke‏ ‎‡A PARK7 and nucleoside diphosphate kinase A as plasma markers for the early diagnosis of stroke‏ ‎‡9 1‏
919 ‎‡a panelomixathresholdbasedalgorithmtocreatepanelsofbiomarkers‏ ‎‡A PanelomiX: A threshold-based algorithm to create panels of biomarkers‏ ‎‡9 1‏
919 ‎‡a palmitateinducedinsulinhypersecretionandlatersecretorydeclineassociatedwithchangesinproteinexpressionpatternsinhumanpancreaticislets‏ ‎‡A Palmitate-Induced Insulin Hypersecretion and Later Secretory Decline Associated with Changes in Protein Expression Patterns in Human Pancreatic Islets‏ ‎‡9 1‏
919 ‎‡a nucleolininteractswithus11proteinofherpessimplexvirus1andisinvolvedinitstrafficking‏ ‎‡A Nucleolin interacts with US11 protein of herpes simplex virus 1 and is involved in its trafficking‏ ‎‡9 1‏
919 ‎‡a nonredundantmassspectrometryastrategytointegratemassspectrometryacquisitionandanalysis‏ ‎‡A Nonredundant mass spectrometry: a strategy to integrate mass spectrometry acquisition and analysis‏ ‎‡9 1‏
919 ‎‡a newperspectivesintheescherichiacoliproteomeinvestigation‏ ‎‡A New perspectives in the Escherichia coli proteome investigation‏ ‎‡9 1‏
919 ‎‡a newmolecularinsightsintomodulationofplateletreactivityinaspirintreatedpatientsusinganetworkbasedapproach‏ ‎‡A New molecular insights into modulation of platelet reactivity in aspirin-treated patients using a network-based approach‏ ‎‡9 1‏
919 ‎‡a newbiomarkersforstagedeterminationintrypanosomabruceirhodesiensesleepingsicknesspatients‏ ‎‡A New biomarkers for stage determination in Trypanosoma brucei rhodesiense sleeping sickness patients‏ ‎‡9 1‏
919 ‎‡a neopterinplasmaconcentrationsinpatientswithaneurysmalsubarachnoidhemorrhagecorrelationwithinfectionandlongtermoutcome‏ ‎‡A Neopterin plasma concentrations in patients with aneurysmal subarachnoid hemorrhage: correlation with infection and long-term outcome.‏ ‎‡9 1‏
919 ‎‡a neopterinisacerebrospinalfluidmarkerfortreatmentoutcomeevaluationinpatientsaffectedbytrypanosomabruceigambiensesleepingsickness‏ ‎‡A Neopterin is a cerebrospinal fluid marker for treatment outcome evaluation in patients affected by Trypanosoma brucei gambiense sleeping sickness‏ ‎‡9 1‏
919 ‎‡a neopterinandcxcl13indiagnosisandfollowupoftrypanosomabruceigambiensesleepingsicknesslessonsfromthefieldinangola‏ ‎‡A Neopterin and CXCL-13 in Diagnosis and Follow-Up of Trypanosoma brucei gambiense Sleeping Sickness: Lessons from the Field in Angola‏ ‎‡9 1‏
919 ‎‡a ntbutyliodoacetamideandiodoacetanilide2newcysteinealkylatingreagentsforrelativequantitationofproteins‏ ‎‡A N-t-butyliodoacetamide and iodoacetanilide: two new cysteine alkylating reagents for relative quantitation of proteins‏ ‎‡9 1‏
919 ‎‡a multipleparametercrossspeciesproteinidentificationusingmultiidentaworldwidewebaccessibletool‏ ‎‡A Multiple parameter cross-species protein identification using MultiIdent--a world-wide web accessible tool.‏ ‎‡9 1‏
919 ‎‡a multilevelomicsforthediscoveryofbiomarkersandtherapeutictargetsforstroke‏ ‎‡A Multilevel omics for the discovery of biomarkers and therapeutic targets for stroke‏ ‎‡9 1‏
919 ‎‡a multidimensionalhplcmsofthenucleolarproteomeusinghplcchipms‏ ‎‡A Multi-dimensional HPLC/MS of the nucleolar proteome using HPLC-chip/MS.‏ ‎‡9 1‏
919 ‎‡a msightanimageanalysissoftwareforliquidchromatographymassspectrometry‏ ‎‡A MSight: an image analysis software for liquid chromatography-mass spectrometry‏ ‎‡9 1‏
919 ‎‡a modulationofneuronalpentraxin1expressioninratpancreaticβcellssubmittedtochronicglucotoxicstress‏ ‎‡A Modulation of neuronal pentraxin 1 expression in rat pancreatic β-cells submitted to chronic glucotoxic stress‏ ‎‡9 1‏
919 ‎‡a modifiedimmobilizedphgradientgelstripequilibrationprocedureinswiss2dpageprotocols‏ ‎‡A Modified immobilized pH gradient gel strip equilibration procedure in SWISS-2DPAGE protocols‏ ‎‡9 1‏
919 ‎‡a modifiedexpressionofplasmaglutathioneperoxidaseandmanganesesuperoxidedismutaseinhumanrenalcellcarcinoma‏ ‎‡A Modified expression of plasma glutathione peroxidase and manganese superoxide dismutase in human renal cell carcinoma‏ ‎‡9 1‏
919 ‎‡a miningmassspectrafordiagnosisandbiomarkerdiscoveryofcerebralaccidents‏ ‎‡A Mining mass spectra for diagnosis and biomarker discovery of cerebral accidents‏ ‎‡9 1‏
919 ‎‡a micropreparative2dimensionalelectrophoresisallowingtheseparationofsamplescontainingmilligramamountsofproteins‏ ‎‡A Micropreparative two-dimensional electrophoresis allowing the separation of samples containing milligram amounts of proteins‏ ‎‡9 1‏
919 ‎‡a methodforidentificationandquantitativeanalysisofproteinlysinemethylationusingmatrixassistedlaserdesorptionionizationtimeofflightmassspectrometryandaminoacidanalysis‏ ‎‡A Method for identification and quantitative analysis of protein lysine methylation using matrix-assisted laser desorption/ionization — time-of-flight mass spectrometry and amino acid analysis‏ ‎‡9 1‏
919 ‎‡a melanie2a3generationsoftwarepackageforanalysisof2dimensionalelectrophoresisimages1featuresanduserinterface‏ ‎‡A Melanie II--a third-generation software package for analysis of two-dimensional electrophoresis images: I. Features and user interface.‏ ‎‡9 1‏
919 ‎‡a mechanismsoflocalinvasioninenteroendocrinetumorsidentificationofnovelcandidatecytoskeletonassociatedproteinsinanexperimentalmousemodelbyaproteomicapproachandvalidationinhumantumors‏ ‎‡A Mechanisms of local invasion in enteroendocrine tumors: identification of novel candidate cytoskeleton-associated proteins in an experimental mouse model by a proteomic approach and validation in human tumors.‏ ‎‡9 1‏
919 ‎‡a measuringserumamyloidaforinfectionpredictioninaneurysmalsubarachnoidhemorrhage‏ ‎‡A Measuring Serum Amyloid A for Infection Prediction in Aneurysmal Subarachnoid Hemorrhage‏ ‎‡9 1‏
919 ‎‡a matrixmetalloproteinase9andintercellularadhesionmolecule1arepowerfulstagingmarkersforhumanafricantrypanosomiasis‏ ‎‡A Matrix metalloproteinase-9 and intercellular adhesion molecule 1 are powerful staging markers for human African trypanosomiasis‏ ‎‡9 1‏
919 ‎‡a matrixmetalloproteinase9andcellularfibronectinplasmaconcentrationsarepredictorsofthecompositeendpointoflengthofstayanddeathintheintensivecareunitafterseveretraumaticbraininjury‏ ‎‡A Matrix metalloproteinase 9 and cellular fibronectin plasma concentrations are predictors of the composite endpoint of length of stay and death in the intensive care unit after severe traumatic brain injury‏ ‎‡9 1‏
919 ‎‡a matrixassistedlaserdesorptionionizationtandemmassspectrometrywithhighresolutionandsensitivityforidentificationandcharacterizationofproteins‏ ‎‡A Matrix-assisted laser desorption/ionization-tandem mass spectrometry with high resolution and sensitivity for identification and characterization of proteins‏ ‎‡9 1‏
919 ‎‡a make2ddbasimplepackagetosetupa2dimensionalelectrophoresisdatabasefortheworldwideweb‏ ‎‡A Make2ddb: a simple package to set up a two-dimensional electrophoresis database for the World Wide Web.‏ ‎‡9 1‏
919 ‎‡a largescaleproteinmodellingandintegrationwiththeswissprotandswiss2dpagedatabasestheexampleofescherichiacoli‏ ‎‡A Large-scale protein modelling and integration with the SWISS-PROT and SWISS-2DPAGE databases: the example of Escherichia coli.‏ ‎‡9 1‏
919 ‎‡a largescaleaminoacidanalysisforproteomestudies‏ ‎‡A Large-scale amino-acid analysis for proteome studies‏ ‎‡9 1‏
919 ‎‡a labelingofbifidobacteriumlongumcellswith13csubstitutedleucineforquantitativeproteomicanalyses‏ ‎‡A Labeling of Bifidobacterium longum cells with 13C-substituted leucine for quantitative proteomic analyses‏ ‎‡9 1‏
919 ‎‡a isolationofnucleoli‏ ‎‡A Isolation of nucleoli‏ ‎‡9 1‏
919 ‎‡a isobarictaggingbasedselectionandquantitationofcerebrospinalfluidtrypticpeptideswithreportercalibrationcurves‏ ‎‡A Isobaric tagging-based selection and quantitation of cerebrospinal fluid tryptic peptides with reporter calibration curves‏ ‎‡9 1‏
919 ‎‡a 3dcellulararchitectureaffectsmicrornaandproteincargoofextracellularvesicles‏ ‎‡A 3D Cellular Architecture Affects MicroRNA and Protein Cargo of Extracellular Vesicles‏ ‎‡9 1‏
919 ‎‡a 98escherichiacoliswiss2dpagedatabaseupdate‏ ‎‡A '98 Escherichia coli SWISS-2DPAGE database update.‏ ‎‡9 1‏
919 ‎‡a clinicalmolecularscannertostudyhumanproteomecomplexity‏ ‎‡A A clinical molecular scanner to study human proteome complexity‏ ‎‡9 1‏
919 ‎‡a combinedcxcl10cxcl8andhfabppanelforthestagingofhumanafricantrypanosomiasispatients‏ ‎‡A A combined CXCL10, CXCL8 and H-FABP panel for the staging of human African trypanosomiasis patients‏ ‎‡9 1‏
919 ‎‡a highglucoselevelisassociatedwithdecreasedaspirinmediatedacetylationofplateletcyclooxygenasecox1atserine529apilotstudy‏ ‎‡A A high glucose level is associated with decreased aspirin-mediated acetylation of platelet cyclooxygenase (COX)-1 at serine 529: A pilot study‏ ‎‡9 1‏
919 ‎‡a molecularscannertoautomateproteomicresearchandtodisplayproteomeimages‏ ‎‡A A molecular scanner to automate proteomic research and to display proteome images‏ ‎‡9 1‏
919 ‎‡a multiparameterpanelmethodforoutcomepredictionfollowinganeurysmalsubarachnoidhemorrhage‏ ‎‡A A multiparameter panel method for outcome prediction following aneurysmal subarachnoid hemorrhage‏ ‎‡9 1‏
919 ‎‡a nonlinearwiderangeimmobilizedphgradientfor2dimensionalelectrophoresisanditsdefinitioninarelevantphscale‏ ‎‡A A nonlinear wide-range immobilized pH gradient for two-dimensional electrophoresis and its definition in a relevant pH scale‏ ‎‡9 1‏
919 ‎‡a novelstrategyusingmascotdistillerforanalysisofcleavableisotopecodedaffinitytagdatatoquantifyproteinchangesinplasma‏ ‎‡A A novel strategy using MASCOT Distiller for analysis of cleavable isotope-coded affinity tag data to quantify protein changes in plasma‏ ‎‡9 1‏
919 ‎‡a panelofcerebrospinalfluidpotentialbiomarkersforthediagnosisofalzheimersdisease‏ ‎‡A A panel of cerebrospinal fluid potential biomarkers for the diagnosis of Alzheimer's disease.‏ ‎‡9 1‏
919 ‎‡a potentialcerebrospinalfluidandplasmaticmarkerforthediagnosisofcreutzfeldtjakobdisease‏ ‎‡A A potential cerebrospinal fluid and plasmatic marker for the diagnosis of Creutzfeldt-Jakob disease‏ ‎‡9 1‏
919 ‎‡a roleforedmandegradationinproteomestudies‏ ‎‡A A role for Edman degradation in proteome studies‏ ‎‡9 1‏
919 ‎‡a 2dimensionalelectrophoreticstudyofserumamyloidaand100reactiveproteinininfantsandchildren‏ ‎‡A A two-dimensional electrophoretic study of serum amyloid A and C-reactive protein in infants and children‏ ‎‡9 1‏
919 ‎‡a accuracyof100reactiveproteinprocalcitoninserumamyloidaandneopterinforlowdosectscanconfirmedpneumoniainelderlypatientsaprospectivecohortstudy‏ ‎‡A Accuracy of C-reactive protein, procalcitonin, serum amyloid A and neopterin for low-dose CT-scan confirmed pneumonia in elderly patients: A prospective cohort study‏ ‎‡9 1‏
919 ‎‡a admissionlevelsoftotaltauandβamyloidisoforms140and142inpredictingtheoutcomeofmildtraumaticbraininjury‏ ‎‡A Admission Levels of Total Tau and β-Amyloid Isoforms 1-40 and 1-42 in Predicting the Outcome of Mild Traumatic Brain Injury‏ ‎‡9 1‏
919 ‎‡a agerelatedproteomeanalysisofthemousebraina2destudy‏ ‎‡A Age-related proteome analysis of the mouse brain: a 2-DE study‏ ‎‡9 1‏
919 ‎‡a integrativemultiomicsworkflowtoaddressmultifactorialtoxicologyexperiments‏ ‎‡A An Integrative Multi-Omics Workflow to Address Multifactorial Toxicology Experiments‏ ‎‡9 1‏
919 ‎‡a analysisofproteinsbydirectscanninginfraredmaldimassspectrometryafter2dpageseparationandelectroblotting‏ ‎‡A Analysis of proteins by direct-scanning infrared-MALDI mass spectrometry after 2D-PAGE separation and electroblotting‏ ‎‡9 1‏
919 ‎‡a analysisofproteomesusingthemolecularscanner‏ ‎‡A Analysis of Proteomes Using the Molecular Scanner‏ ‎‡9 1‏
919 ‎‡a antiapolipoproteina1iggsareassociatedwithhighlevelsofoxidizedlowdensitylipoproteininacutecoronarysyndrome‏ ‎‡A Anti-(apolipoprotein A-1) IgGs are associated with high levels of oxidized low-density lipoprotein in acute coronary syndrome‏ ‎‡9 1‏
919 ‎‡a apoc1andapoc3aspotentialplasmaticmarkerstodistinguishbetweenischemicandhemorrhagicstroke‏ ‎‡A ApoC-I and ApoC-III as potential plasmatic markers to distinguish between ischemic and hemorrhagic stroke‏ ‎‡9 1‏
919 ‎‡a assessingcerebrospinalfluidrhinorrheaa2dimensionalelectrophoresisapproach‏ ‎‡A Assessing cerebrospinal fluid rhinorrhea: a two-dimensional electrophoresis approach‏ ‎‡9 1‏
919 ‎‡a assignmentofproteinfunctionanddiscoveryofnovelnucleolarproteinsbasedonautomaticanalysisofmedline‏ ‎‡A Assignment of protein function and discovery of novel nucleolar proteins based on automatic analysis of MEDLINE‏ ‎‡9 1‏
919 ‎‡a bioinformaticsforproteinbiomarkerpanelclassificationwhatisneededtobringbiomarkerpanelsintoinvitrodiagnostics‏ ‎‡A Bioinformatics for protein biomarker panel classification: what is needed to bring biomarker panels into in vitro diagnostics?‏ ‎‡9 1‏
919 ‎‡a biomarkerspredictivevalueforearlydiagnosisofstrokeassociatedpneumonia‏ ‎‡A Biomarkers predictive value for early diagnosis of Stroke-Associated Pneumonia‏ ‎‡9 1‏
919 ‎‡a biotinproductionunderlimitinggrowthconditionsbyagrobacteriumrhizobiumhk4transformedwithamodifiedescherichiacolibiooperon‏ ‎‡A Biotin production under limiting growth conditions by Agrobacterium/Rhizobium HK4 transformed with a modified Escherichia coli bio operon‏ ‎‡9 1‏
919 ‎‡a bloodglutathionestransferaseπasatimeindicatorofstrokeonset‏ ‎‡A Blood glutathione S-transferase-π as a time indicator of stroke onset‏ ‎‡9 1‏
919 ‎‡a brainextracellularfluidproteinchangesinacutestrokepatients‏ ‎‡A Brain Extracellular Fluid Protein Changes in Acute Stroke Patients‏ ‎‡9 1‏
919 ‎‡a bronchoalveolarlavagefluidproteincompositioninpatientswithsarcoidosisandidiopathicpulmonaryfibrosisa2dimensionalelectrophoreticstudy‏ ‎‡A Bronchoalveolar lavage fluid protein composition in patients with sarcoidosis and idiopathic pulmonary fibrosis: a two-dimensional electrophoretic study‏ ‎‡9 1‏
919 ‎‡a cardiacbiomarkerslevelspredictpulmonaryembolismextentonchestcomputedtomographyandprognosisinnonmassivepulmonaryembolism‏ ‎‡A Cardiac biomarkers levels predict pulmonary embolism extent on chest computed tomography and prognosis in non-massive pulmonary embolism.‏ ‎‡9 1‏
919 ‎‡a cerebralischemiceventsinpatientswithpancreaticcancer‏ ‎‡A Cerebral ischemic events in patients with pancreatic cancer‏ ‎‡9 1‏
919 ‎‡a cerebralischemiceventsinpatientswithpancreaticcanceraretrospectivecohortstudyof17patientsandaliteraturereview‏ ‎‡A Cerebral ischemic events in patients with pancreatic cancer: A retrospective cohort study of 17 patients and a literature review‏ ‎‡9 1‏
919 ‎‡a cerebrospinalfluidderivedmicrovesiclesfromsleepingsicknesspatientsalterproteinexpressioninhumanastrocytes‏ ‎‡A Cerebrospinal Fluid-Derived Microvesicles From Sleeping Sickness Patients Alter Protein Expression in Human Astrocytes‏ ‎‡9 1‏
919 ‎‡a cerebrospinalfluidneopterinasmarkerofthemeningoencephaliticstageoftrypanosomabruceigambiensesleepingsickness‏ ‎‡A Cerebrospinal fluid neopterin as marker of the meningo-encephalitic stage of Trypanosoma brucei gambiense sleeping sickness‏ ‎‡9 1‏
919 ‎‡a characterisationoftheinfluencesofaspirinacetylationandglycationonhumanplasmaproteins‏ ‎‡A Characterisation of the influences of aspirin-acetylation and glycation on human plasma proteins.‏ ‎‡9 1‏
919 ‎‡a characterizationofheatshockprotein27phosphorylationsitesinrenalcellcarcinoma‏ ‎‡A Characterization of heat shock protein 27 phosphorylation sites in renal cell carcinoma.‏ ‎‡9 1‏
919 ‎‡a characterizationoftheglycatedhumancerebrospinalfluidproteome‏ ‎‡A Characterization of the glycated human cerebrospinal fluid proteome‏ ‎‡9 1‏
919 ‎‡a characterizationoftheplateletgranuleproteomeevidenceofthepresenceofmhc1in Alpha granules‏ ‎‡A Characterization of the platelet granule proteome: evidence of the presence of MHC1 in Alpha -granules.‏ ‎‡9 1‏
919 ‎‡a colloidalcarriersforintravenousdrugtargetingplasmaproteinadsorptionpatternsonsurfacemodifiedlatexparticlesevaluatedby2dimensionalpolyacrylamidegelelectrophoresis‏ ‎‡A Colloidal carriers for intravenous drug targeting: plasma protein adsorption patterns on surface-modified latex particles evaluated by two-dimensional polyacrylamide gel electrophoresis‏ ‎‡9 1‏
919 ‎‡a combinedlipidomicandproteomicanalysisofisolatedhumanisletsexposedtopalmitaterevealstimedependentchangesininsulinsecretionandlipidmetabolism‏ ‎‡A Combined lipidomic and proteomic analysis of isolated human islets exposed to palmitate reveals time-dependent changes in insulin secretion and lipid metabolism‏ ‎‡9 1‏
919 ‎‡a combininghfabpandgfapincreasesthecapacitytodifferentiatebetweenctpositiveandctnegativepatientswithmildtraumaticbraininjury‏ ‎‡A Combining H-FABP and GFAP increases the capacity to differentiate between CT-positive and CT-negative patients with mild traumatic brain injury.‏ ‎‡9 1‏
919 ‎‡a combininglowandhighenergytandemmassspectraforoptimizedpeptidequantificationwithisobarictags‏ ‎‡A Combining low- and high-energy tandem mass spectra for optimized peptide quantification with isobaric tags‏ ‎‡9 1‏
919 ‎‡a comparativeanalysisofcerebrospinalfluidfromthemeningoencephaliticstageoftbgambienseandrhodesiensesleepingsicknesspatientsusingtmtquantitativeproteomics‏ ‎‡A Comparative analysis of cerebrospinal fluid from the meningo-encephalitic stage of T. b. gambiense and rhodesiense sleeping sickness patients using TMT quantitative proteomics‏ ‎‡9 1‏
919 ‎‡a comprehensiveproteomeanalysisbychromatographicproteinprefractionation‏ ‎‡A Comprehensive proteome analysis by chromatographic protein prefractionation.‏ ‎‡9 1‏
919 ‎‡a contributionofproteomicstothemolecularanalysisofrenalcellcarcinomawithanemphasisonmanganesesuperoxidedismutase‏ ‎‡A Contribution of proteomics to the molecular analysis of renal cell carcinoma with an emphasis on manganese superoxide dismutase‏ ‎‡9 1‏
919 ‎‡a correlationbetweencardiacbiomarkersandrightventricularenlargementonchestctinnonmassivepulmonaryembolism‏ ‎‡A Correlation between cardiac biomarkers and right ventricular enlargement on chest CT in non massive pulmonary embolism.‏ ‎‡9 1‏
919 ‎‡a correlationofproteomicandtranscriptomicprofilesofstaphylococcusaureusduringthepostexponenti Alpha seofgrowth‏ ‎‡A Correlation of proteomic and transcriptomic profiles of Staphylococcus aureus during the post-exponential phase of growth.‏ ‎‡9 1‏
919 ‎‡a currentchallengesandfutureapplicationsforproteinmapsandposttranslationalvectormapsinproteomeprojects‏ ‎‡A Current challenges and future applications for protein maps and post-translational vector maps in proteome projects‏ ‎‡9 1‏
919 ‎‡a currentstatusoftheswiss2dpagedatabase‏ ‎‡A Current status of the SWISS-2DPAGE database‏ ‎‡9 1‏
919 ‎‡a cystatin100asapotentialcerebrospinalfluidmarkerforthediagnosisofcreutzfeldtjakobdisease‏ ‎‡A Cystatin C as a potential cerebrospinal fluid marker for the diagnosis of Creutzfeldt-Jakob disease.‏ ‎‡9 1‏
919 ‎‡a cysteinereactivecovalentcapturetagsforenrichmentofcysteinecontainingpeptides‏ ‎‡A Cysteine-reactive covalent capture tags for enrichment of cysteine-containing peptides‏ ‎‡9 1‏
919 ‎‡a cysteinetaggingformsbasedproteomics‏ ‎‡A Cysteine tagging for MS-based proteomics‏ ‎‡9 1‏
919 ‎‡a decipheringthehumannucleolarproteome‏ ‎‡A Deciphering the human nucleolar proteome‏ ‎‡9 1‏
919 ‎‡a isg20l2anovelvertebratenucleolarexoribonucleaseinvolvedinribosomebiogenesis‏ ‎‡A ISG20L2, a novel vertebrate nucleolar exoribonuclease involved in ribosome biogenesis‏ ‎‡9 1‏
919 ‎‡a intracellularandextracellularmarkersoflethalityinosteogenesisimperfectaaquantitativeproteomicapproach‏ ‎‡A Intracellular and Extracellular Markers of Lethality in Osteogenesis Imperfecta: A Quantitative Proteomic Approach‏ ‎‡9 1‏
919 ‎‡a detailedpeptidecharacterizationusingpeptidemassaworldwidewebaccessibletool‏ ‎‡A Detailed peptide characterization using PEPTIDEMASS--a World-Wide-Web-accessible tool.‏ ‎‡9 1‏
919 ‎‡a interleukin10andheartfattyacidbindingproteinasearlyoutcomepredictorsinpatientswithtraumaticbraininjury‏ ‎‡A Interleukin 10 and Heart Fatty Acid-Binding Protein as Early Outcome Predictors in Patients With Traumatic Brain Injury‏ ‎‡9 1‏
919 ‎‡a detectionofbiomarkersofstrokeusingselditof‏ ‎‡A Detection of biomarkers of stroke using SELDI-TOF.‏ ‎‡9 1‏
919 ‎‡a integrating2dimensionalgeldatabasesusingthemelanie2software‏ ‎‡A Integrating two-dimensional gel databases using the Melanie II software.‏ ‎‡9 1‏
919 ‎‡a diagnosticperformanceofperoxiredoxin1todeterminetimeofonsetofacutecerebralinfarction‏ ‎‡A Diagnostic performance of peroxiredoxin 1 to determine time-of-onset of acute cerebral infarction‏ ‎‡9 1‏
919 ‎‡a insideswiss2dpagedatabase‏ ‎‡A Inside SWISS-2DPAGE database‏ ‎‡9 1‏
919 ‎‡a discoveryandverificationofosteopontinandbeta2microglobulinaspromisingmarkersforstaginghumanafricantrypanosomiasis‏ ‎‡A Discovery and verification of osteopontin and Beta-2-microglobulin as promising markers for staging human African trypanosomiasis‏ ‎‡9 1‏
919 ‎‡a inhibitionofinsulinsecretionbybetagraninannterminalchromograninafragment‏ ‎‡A Inhibition of insulin secretion by betagranin, an N-terminal chromogranin A fragment‏ ‎‡9 1‏
919 ‎‡a eselectinandvascularcelladhesionmolecule1asbiomarkersof3monthoutcomeincerebrovasculardiseases‏ ‎‡A E-selectin and vascular cell adhesion molecule-1 as biomarkers of 3-month outcome in cerebrovascular diseases‏ ‎‡9 1‏
919 ‎‡a earlyactivationofthefattyacidmetabolismpathwaybychronichighglucoseexposureinratinsulinsecretorybetacells‏ ‎‡A Early activation of the fatty acid metabolism pathway by chronic high glucose exposure in rat insulin secretory beta-cells‏ ‎‡9 1‏
919 ‎‡a informationtransferbetweenlargeandsmall2dimensionalpolyacrylamidegelelectrophoresis‏ ‎‡A Information transfer between large and small two-dimensional polyacrylamide gel electrophoresis‏ ‎‡9 1‏
919 ‎‡a earlylevelsofglialfibrillaryacidicproteinandneurofilamentlightproteininpredictingtheoutcomeofmildtraumaticbraininjury‏ ‎‡A Early Levels of Glial Fibrillary Acidic Protein and Neurofilament Light Protein in Predicting the Outcome of Mild Traumatic Brain Injury‏ ‎‡9 1‏
919 ‎‡a earlymeasurementofinterleukin10predictstheabsenceofctscanlesionsinmildtraumaticbraininjury‏ ‎‡A Early measurement of interleukin-10 predicts the absence of CT scan lesions in mild traumatic brain injury.‏ ‎‡9 1‏
919 ‎‡a easyprotaneasytousegraphicalplatformforproteomicsdataanalysis‏ ‎‡A EasyProt--an easy-to-use graphical platform for proteomics data analysis‏ ‎‡9 1‏
919 ‎‡a ingelsamplerehydrationofimmobilizedphgradient‏ ‎‡A In-gel sample rehydration of immobilized pH gradient‏ ‎‡9 1‏
919 ‎‡a improvingthedetectionofproteinsaftertransfertopolyvinylidenedifluoridemembranes‏ ‎‡A Improving the detection of proteins after transfer to polyvinylidene difluoride membranes‏ ‎‡9 1‏
919 ‎‡a effectofhighfatdietontheexpressionofproteinsinmuscleadiposetissuesandliverofc57bl6mice‏ ‎‡A Effect of high-fat diet on the expression of proteins in muscle, adipose tissues, and liver of C57BL/6 mice‏ ‎‡9 1‏
919 ‎‡a improvingproteinidentificationfrompeptidemassfingerprintingthroughaparameterizedmultilevelscoringalgorithmandanoptimizedpeakdetection‏ ‎‡A Improving protein identification from peptide mass fingerprinting through a parameterized multi-level scoring algorithm and an optimized peak detection‏ ‎‡9 1‏
919 ‎‡a effectofrosiglitazoneonthedifferentialexpressionofdiabetesassociatedproteinsinpancreaticisletsofc57bl6leplepmice‏ ‎‡A Effect of rosiglitazone on the differential expression of diabetes-associated proteins in pancreatic islets of C57Bl/6 lep/lep mice‏ ‎‡9 1‏
919 ‎‡a improvedcharacterizationoftheinsulinsecretorygranuleproteomes‏ ‎‡A Improved characterization of the insulin secretory granule proteomes‏ ‎‡9 1‏
919 ‎‡a improvedandsimplifiedingelsampleapplicationusingreswellingofdryimmobilizedphgradients‏ ‎‡A Improved and simplified in-gel sample application using reswelling of dry immobilized pH gradients‏ ‎‡9 1‏
919 ‎‡a effectofrosiglitazoneonthedifferentialexpressionofobesityandinsulinresistanceassociatedproteinsinleplepmice‏ ‎‡A Effect of rosiglitazone on the differential expression of obesity and insulin resistance associated proteins in lep/lep mice‏ ‎‡9 1‏
919 ‎‡a elevationofapolipoproteineinthecsfofcattleaffectedbybse‏ ‎‡A Elevation of apolipoprotein E in the CSF of cattle affected by BSE‏ ‎‡9 1‏
919 ‎‡a enhancedproteinrecoveryafterelectrotransferusingsquarewavealternatingvoltage‏ ‎‡A Enhanced protein recovery after electrotransfer using square wave alternating voltage.‏ ‎‡9 1‏
919 ‎‡a igmareassociatedtosp Alpha cd5antigenlike‏ ‎‡A IgM are associated to Sp Alpha (CD5 antigen-like)‏ ‎‡9 1‏
919 ‎‡a identificationofspecificproteinsindifferentlymphocytepopulationsbyproteomictools‏ ‎‡A Identification of specific proteins in different lymphocyte populations by proteomic tools‏ ‎‡9 1‏
919 ‎‡a identificationofribosomeassociatedviralandcellularbasicproteinsduringthecourseofinfectionwithherpessimplexvirustype1‏ ‎‡A Identification of ribosome-associated viral and cellular basic proteins during the course of infection with herpes simplex virus type 1.‏ ‎‡9 1‏
919 ‎‡a identificationofproteinsbytheiraminoacidcompositionanevaluationofthemethod‏ ‎‡A Identification of proteins by their amino acid composition: an evaluation of the method.‏ ‎‡9 1‏
919 ‎‡a enrichmentofnterminalcysteinylpeptidesbycovalentcapture‏ ‎‡A Enrichment of N-terminal cysteinyl-peptides by covalent capture‏ ‎‡9 1‏
919 ‎‡a evaluationofantigensfordevelopmentofaserologicaltestforhumanafricantrypanosomiasis‏ ‎‡A Evaluation of Antigens for Development of a Serological Test for Human African Trypanosomiasis‏ ‎‡9 1‏
919 ‎‡a evaluationoftheabilityofbifidobacteriumlongumtometabolizehumanintestinalmucus‏ ‎‡A Evaluation of the ability of Bifidobacterium longum to metabolize human intestinal mucus.‏ ‎‡9 1‏
919 ‎‡a exploitationofspecificpropertiesoftrifluoroethanolforextractionandseparationofmembraneproteins‏ ‎‡A Exploitation of specific properties of trifluoroethanol for extraction and separation of membrane proteins‏ ‎‡9 1‏
919 ‎‡a exploringglycopeptideresistanceinstaphylococcusaureusacombinedproteomicsandtranscriptomicsapproachfortheidentificationofresistancerelatedmarkers‏ ‎‡A Exploring glycopeptide-resistance in Staphylococcus aureus: a combined proteomics and transcriptomics approach for the identification of resistance-related markers.‏ ‎‡9 1‏
919 ‎‡a extractionofmembraneproteinsbydifferentialsolubilizationforseparationusing2dimensionalgelelectrophoresis‏ ‎‡A Extraction of membrane proteins by differential solubilization for separation using two-dimensional gel electrophoresis‏ ‎‡9 1‏
919 ‎‡a fattyacidbindingproteinasaserummarkerfortheearlydiagnosisofstrokeapilotstudy‏ ‎‡A Fatty acid binding protein as a serum marker for the early diagnosis of stroke: a pilot study‏ ‎‡9 1‏
919 ‎‡a federated2dimensionalelectrophoresisdatabaseasimplemeansofpublishing2dimensionalelectrophoresisdata‏ ‎‡A Federated two-dimensional electrophoresis database: a simple means of publishing two-dimensional electrophoresis data‏ ‎‡9 1‏
919 ‎‡a fractalkinecx3cl1anewfactorprotectingβcellsagainsttnfα‏ ‎‡A Fractalkine (CX3CL1), a new factor protecting β-cells against TNFα‏ ‎‡9 1‏
919 ‎‡a frombraintobloodnewbiomarkersforischemicstrokeprognosis‏ ‎‡A From brain to blood: New biomarkers for ischemic stroke prognosis‏ ‎‡9 1‏
919 ‎‡a fromproteinstoproteomeslargescaleproteinidentificationby2dimensionalelectrophoresisandaminoacidanalysis‏ ‎‡A From proteins to proteomes: large scale protein identification by two-dimensional electrophoresis and amino acid analysis‏ ‎‡9 1‏
919 ‎‡a fromrelativetoabsolutequantificationoftrypticpeptideswithtandemmasstagsapplicationtocerebrospinalfluid‏ ‎‡A From relative to absolute quantification of tryptic peptides with tandem mass tags: application to cerebrospinal fluid‏ ‎‡9 1‏
919 ‎‡a functionalproteomicanalysisofhumannucleolus‏ ‎‡A Functional proteomic analysis of human nucleolus‏ ‎‡9 1‏
919 ‎‡a generalstatisticalmodelingofdatafromproteinrelativeexpressionisobarictags‏ ‎‡A General statistical modeling of data from protein relative expression isobaric tags.‏ ‎‡9 1‏
919 ‎‡a glucotoxicityandpancreaticproteomics‏ ‎‡A Glucotoxicity and pancreatic proteomics‏ ‎‡9 1‏
919 ‎‡a glycationisotopiclabelingwith13creducingsugarsforquantitativeanalysisofglycatedproteinsinhumanplasma‏ ‎‡A Glycation isotopic labeling with 13C-reducing sugars for quantitative analysis of glycated proteins in human plasma‏ ‎‡9 1‏
919 ‎‡a goldcoatingofnonconductivemembranesbeforematrixassistedlaserdesorptionionizationtandemmassspectrometricanalysispreventschargingeffect‏ ‎‡A Gold coating of non-conductive membranes before matrix-assisted laser desorption/ionization tandem mass spectrometric analysis prevents charging effect‏ ‎‡9 1‏
919 ‎‡a hfabpanewbiomarkertodifferentiatebetweenctpositiveandctnegativepatientswithmildtraumaticbraininjury‏ ‎‡A H-FABP: A new biomarker to differentiate between CT-positive and CT-negative patients with mild traumatic brain injury.‏ ‎‡9 1‏
919 ‎‡a heartfattyacidbindingproteinasamarkerforearlydetectionofacutemyocardialinfarctionandstroke‏ ‎‡A Heart-fatty acid-binding protein as a marker for early detection of acute myocardial infarction and stroke.‏ ‎‡9 1‏
919 ‎‡a identificationofpostmortemcerebrospinalfluidproteinsaspotentialbiomarkersofischemiaandneurodegeneration‏ ‎‡A Identification of post-mortem cerebrospinal fluid proteins as potential biomarkers of ischemia and neurodegeneration.‏ ‎‡9 1‏
919 ‎‡a highthroughputmassspectrometricdiscoveryofproteinposttranslationalmodifications‏ ‎‡A High-throughput mass spectrometric discovery of protein post-translational modifications.‏ ‎‡9 1‏
919 ‎‡a highlightsofthebiologyanddiseasedrivenhumanproteomeproject2015‏ ‎‡A Highlights of the Biology and Disease-driven Human Proteome Project, 2015-2016.‏ ‎‡9 1‏
919 ‎‡a hsv1cgal+infectionpromotesquakingrnabindingproteinproductionandinducesnuclearcytoplasmicshuttlingofquaking15isoforminhumanhepatomacells‏ ‎‡A HSV-1 Cgal+ infection promotes quaking RNA binding protein production and induces nuclear-cytoplasmic shuttling of quaking I-5 isoform in human hepatoma cells‏ ‎‡9 1‏
919 ‎‡a humanbloodplateletproteinmapestablishedby2dimensionalpolyacrylamidegelelectrophoresis‏ ‎‡A Human blood platelet protein map established by two-dimensional polyacrylamide gel electrophoresis‏ ‎‡9 1‏
919 ‎‡a humangingivalcrevicularfluidcontainsmrp8s100a8andmrp14s100a92calciumbindingproteinsofthes100family‏ ‎‡A Human gingival crevicular fluid contains MRP8 (S100A8) and MRP14 (S100A9), two calcium-binding proteins of the S100 family‏ ‎‡9 1‏
919 ‎‡a identificationofhumanratandchickenribosomalproteinsbyacombinationof2dimensionalpolyacrylamidegelelectrophoresisandmassspectrometry‏ ‎‡A Identification of human, rat and chicken ribosomal proteins by a combination of two-dimensional polyacrylamide gel electrophoresis and mass spectrometry‏ ‎‡9 1‏
919 ‎‡a identificationofbraincelldeathassociatedproteinsinhumanpostmortemcerebrospinalfluid‏ ‎‡A Identification of brain cell death associated proteins in human post-mortem cerebrospinal fluid‏ ‎‡9 1‏
919 ‎‡a humanhemolysateglycatedproteome‏ ‎‡A Human hemolysate glycated proteome‏ ‎‡9 1‏
919 ‎‡a hydrogendeuteriumexchangeforhigherspecificityofproteinidentificationbypeptidemassfingerprinting‏ ‎‡A Hydrogen/deuterium exchange for higher specificity of protein identification by peptide mass fingerprinting‏ ‎‡9 1‏
919 ‎‡a humanliverproteinmapareferencedatabaseestablishedbymicrosequencingandgelcomparison‏ ‎‡A Human liver protein map: a reference database established by microsequencing and gel comparison‏ ‎‡9 1‏
919 ‎‡a humanliverproteinmapupdate‏ ‎‡A Human liver protein map: Update 1993‏ ‎‡9 1‏
943 ‎‡a 199x‏ ‎‡A 1995‏ ‎‡9 3‏
943 ‎‡a 201x‏ ‎‡A 2016‏ ‎‡9 1‏
996 ‎‡2 LC|no2014120511‏
996 ‎‡2 LC|ns2012002593‏
996 ‎‡2 ISNI|0000000045129458‏
996 ‎‡2 DNB|1213300908‏
996 ‎‡2 BNC|981061132544406706‏
996 ‎‡2 BNE|XX5777041‏
996 ‎‡2 LC|no 95040146‏
996 ‎‡2 BNE|XX6386081‏
996 ‎‡2 BNE|XX6311558‏
996 ‎‡2 LC|no2008045545‏
996 ‎‡2 LC|no2015141316‏
996 ‎‡2 SUDOC|110829115‏
996 ‎‡2 LC|n 82093737‏
996 ‎‡2 SUDOC|164452923‏
996 ‎‡2 BNF|16422255‏
996 ‎‡2 LC|no2022010177‏
996 ‎‡2 LC|n 2024007061‏
996 ‎‡2 DNB|1076681123‏
996 ‎‡2 ISNI|0000000040018310‏
996 ‎‡2 BNE|XX1247450‏
996 ‎‡2 DNB|1057474878‏
996 ‎‡2 CAOONL|ncf11456096‏
996 ‎‡2 ISNI|0000000083385276‏
996 ‎‡2 RERO|A016578215‏
996 ‎‡2 SZ|1052300758‏
996 ‎‡2 PLWABN|9810689021705606‏
996 ‎‡2 SUDOC|035020830‏
996 ‎‡2 BNF|13532617‏
996 ‎‡2 BNE|XX6136684‏
996 ‎‡2 DNB|1251805426‏
996 ‎‡2 BNE|XX5139222‏
996 ‎‡2 DNB|1158656424‏
996 ‎‡2 ISNI|0000000035579009‏
996 ‎‡2 BNE|XX904318‏
996 ‎‡2 LC|no2009017922‏
996 ‎‡2 NTA|338928545‏
996 ‎‡2 ISNI|0000000362489641‏
996 ‎‡2 BNE|XX4786828‏
996 ‎‡2 BNE|XX1094029‏
996 ‎‡2 LC|no2012125487‏
996 ‎‡2 BNE|XX824524‏
996 ‎‡2 LC|no2007022982‏
996 ‎‡2 NUKAT|nx2024007077‏
996 ‎‡2 SUDOC|201864053‏
996 ‎‡2 LC|no2015021542‏
996 ‎‡2 LC|n 2020005980‏
996 ‎‡2 NKC|jx20080602027‏
996 ‎‡2 LC|no2021106966‏
996 ‎‡2 BNE|XX1756034‏
996 ‎‡2 DNB|14072804X‏
996 ‎‡2 LC|ns2020000921‏
996 ‎‡2 DNB|1057338400‏
996 ‎‡2 SUDOC|184293669‏
996 ‎‡2 DNB|188356460‏
996 ‎‡2 BNC|981059272201406706‏
996 ‎‡2 BNE|XX1434239‏
996 ‎‡2 LC|n 2007026314‏
996 ‎‡2 SUDOC|200484524‏
996 ‎‡2 DNB|1337239720‏
996 ‎‡2 ISNI|0000000389121492‏
996 ‎‡2 DNB|1053087039‏
996 ‎‡2 BNC|981058512484206706‏
996 ‎‡2 LC|n 2014029553‏
996 ‎‡2 ISNI|0000000071400790‏
996 ‎‡2 NDL|032608519‏
996 ‎‡2 BNE|XX891421‏
996 ‎‡2 ISNI|0000000033002863‏
996 ‎‡2 BNC|981061121376906706‏
996 ‎‡2 BNE|XX1430956‏
996 ‎‡2 BNE|XX1090474‏
996 ‎‡2 ISNI|0000000039944915‏
996 ‎‡2 ISNI|0000000053404990‏
996 ‎‡2 ISNI|0000000046247309‏
996 ‎‡2 J9U|987007357768605171‏
996 ‎‡2 BNF|15896890‏
996 ‎‡2 BNE|XX1029984‏
996 ‎‡2 BNE|XX831092‏
996 ‎‡2 BNE|XX5462680‏
996 ‎‡2 RERO|A027095628‏
996 ‎‡2 DNB|1296748669‏
996 ‎‡2 LC|n 2011006577‏
996 ‎‡2 ISNI|0000000117535886‏
996 ‎‡2 DNB|1056478411‏
996 ‎‡2 BNF|16920453‏
996 ‎‡2 DNB|1057044296‏
996 ‎‡2 NTA|078285070‏
996 ‎‡2 J9U|987010649072305171‏
996 ‎‡2 SUDOC|199574014‏
996 ‎‡2 LC|no 99054616‏
996 ‎‡2 ISNI|0000000042784473‏
996 ‎‡2 BNE|XX835795‏
996 ‎‡2 ISNI|0000000068998138‏
996 ‎‡2 LC|no2007064526‏
996 ‎‡2 NUKAT|n 2010043256‏
996 ‎‡2 ISNI|0000000059599100‏
996 ‎‡2 LC|no 98117626‏
996 ‎‡2 LC|n 2017054174‏
996 ‎‡2 BNC|981058608369306706‏
996 ‎‡2 BNE|XX1023706‏
996 ‎‡2 BNF|16506785‏
996 ‎‡2 LC|n 2010014948‏
996 ‎‡2 LC|no2009166970‏
996 ‎‡2 J9U|987009541283305171‏
996 ‎‡2 BNE|XX5080669‏
996 ‎‡2 SUDOC|169741737‏
996 ‎‡2 DNB|118600150X‏
996 ‎‡2 ISNI|0000000060338178‏
996 ‎‡2 J9U|987007301462905171‏
996 ‎‡2 LC|no2011087899‏
996 ‎‡2 BNE|XX888430‏
996 ‎‡2 BNE|XX6182798‏
996 ‎‡2 J9U|987007428551205171‏
996 ‎‡2 ISNI|0000000081991686‏
996 ‎‡2 LC|no2006133467‏
996 ‎‡2 DNB|142462284‏
996 ‎‡2 DNB|1055979336‏
996 ‎‡2 ISNI|0000000059687258‏
996 ‎‡2 ISNI|0000000059942845‏
996 ‎‡2 NUKAT|n 2020216016‏
996 ‎‡2 LC|no 97038896‏
996 ‎‡2 SUDOC|230307914‏
996 ‎‡2 LC|no2011074340‏
996 ‎‡2 BNE|XX944478‏
996 ‎‡2 NSK|000280507‏
996 ‎‡2 BNCHL|10000000000000000817317‏
996 ‎‡2 BNE|XX4966449‏
996 ‎‡2 ISNI|0000000061122723‏
996 ‎‡2 LC|no2024108728‏
996 ‎‡2 J9U|987007396002905171‏
996 ‎‡2 BNE|XX5116628‏
996 ‎‡2 BNE|XX1297519‏
996 ‎‡2 LC|no2009170604‏
996 ‎‡2 SUDOC|118941690‏
996 ‎‡2 SUDOC|22834560X‏
996 ‎‡2 BNE|XX994607‏
996 ‎‡2 SUDOC|273266233‏
996 ‎‡2 BNC|981058525080106706‏
996 ‎‡2 NYNYRILM|278862‏
996 ‎‡2 ISNI|0000000509842391‏
996 ‎‡2 BNC|981061132418806706‏
996 ‎‡2 DNB|1115274937‏
996 ‎‡2 SUDOC|184140463‏
996 ‎‡2 BNCHL|10000000000000000810717‏
996 ‎‡2 ISNI|0000000114555216‏
996 ‎‡2 NTA|075270870‏
996 ‎‡2 NTA|111881765‏
996 ‎‡2 LC|n 94091489‏
996 ‎‡2 DNB|121269984X‏
996 ‎‡2 SUDOC|189013028‏
996 ‎‡2 DNB|1193271126‏
996 ‎‡2 LC|no2015031962‏
996 ‎‡2 SUDOC|069885192‏
996 ‎‡2 BNE|XX1108441‏
996 ‎‡2 BNE|XX6472235‏
996 ‎‡2 BIBSYS|90896140‏
996 ‎‡2 ISNI|000000004422607X‏
996 ‎‡2 ISNI|0000000358266453‏
996 ‎‡2 ISNI|000000011891102X‏
996 ‎‡2 DNB|1038286638‏
996 ‎‡2 BNC|981058610760106706‏
996 ‎‡2 BNCHL|10000000000000000835916‏
996 ‎‡2 DNB|1201206553‏
996 ‎‡2 BIBSYS|10080631‏
996 ‎‡2 BNCHL|10000000000000000074453‏
996 ‎‡2 BNE|XX1177365‏
996 ‎‡2 SUDOC|272332623‏
996 ‎‡2 DNB|1117047458‏
996 ‎‡2 ISNI|0000000060649574‏
996 ‎‡2 RERO|A003883322‏
996 ‎‡2 LC|n 86052768‏
996 ‎‡2 ISNI|0000000060061850‏
996 ‎‡2 LC|no2023038295‏
996 ‎‡2 ISNI|0000000059303672‏
996 ‎‡2 BNE|XX4866243‏
996 ‎‡2 BNE|XX967761‏
996 ‎‡2 LC|no2009019123‏
996 ‎‡2 RERO|A003883372‏
996 ‎‡2 PLWABN|9810540887905606‏
996 ‎‡2 NII|DA14264248‏
996 ‎‡2 BNC|981058525213706706‏
996 ‎‡2 DNB|1056672366‏
996 ‎‡2 ISNI|0000000514293278‏
996 ‎‡2 BNC|981058614219206706‏
996 ‎‡2 BNE|XX1119299‏
996 ‎‡2 LC|n 94068014‏
996 ‎‡2 ISNI|0000000069913511‏
996 ‎‡2 BNC|981058581295906706‏
996 ‎‡2 BLBNB|000283227‏
996 ‎‡2 LC|no2008185630‏
996 ‎‡2 ISNI|0000000105881378‏
996 ‎‡2 B2Q|0000347010‏
996 ‎‡2 KRNLK|KAC2020S6568‏
996 ‎‡2 RERO|A013210817‏
996 ‎‡2 BNF|12475632‏
996 ‎‡2 BNF|13748690‏
996 ‎‡2 BNE|XX1657021‏
996 ‎‡2 ISNI|0000000116681507‏
996 ‎‡2 LC|ns2018002837‏
996 ‎‡2 SUDOC|123026385‏
996 ‎‡2 LC|no2012116205‏
996 ‎‡2 BNE|XX940974‏
996 ‎‡2 SZ|1116976889‏
996 ‎‡2 LC|n 91028198‏
996 ‎‡2 ISNI|0000000060638744‏
996 ‎‡2 NUKAT|n 2014090213‏
996 ‎‡2 BNE|XX1726416‏
996 ‎‡2 ISNI|000000006086563X‏
996 ‎‡2 BNE|XX1346182‏
996 ‎‡2 DNB|1210599740‏
996 ‎‡2 BNC|981058612621606706‏
996 ‎‡2 DNB|13380058X‏
996 ‎‡2 ISNI|0000000389624401‏
996 ‎‡2 LC|n 93093346‏
996 ‎‡2 BNC|981058511992906706‏
996 ‎‡2 ISNI|0000000059685252‏
996 ‎‡2 NTA|423450220‏
996 ‎‡2 ISNI|0000000060773540‏
996 ‎‡2 SUDOC|088790460‏
996 ‎‡2 BNE|XX5392344‏
996 ‎‡2 BNE|XX1549861‏
996 ‎‡2 ISNI|0000000115389141‏
996 ‎‡2 ISNI|0000000132435437‏
996 ‎‡2 ISNI|0000000433888931‏
996 ‎‡2 BNE|XX1078911‏
996 ‎‡2 DNB|1047417383‏
996 ‎‡2 SUDOC|166802522‏
996 ‎‡2 BNE|XX1035488‏
996 ‎‡2 BNE|XX1116569‏
996 ‎‡2 LC|no2014071389‏
996 ‎‡2 LC|ns2015003844‏
996 ‎‡2 LC|n 93107195‏
996 ‎‡2 ISNI|0000000116964232‏
996 ‎‡2 ISNI|0000000079887791‏
996 ‎‡2 SUDOC|052500721‏
996 ‎‡2 ISNI|0000000037459967‏
996 ‎‡2 NUKAT|n 2014080930‏
996 ‎‡2 ISNI|0000000503949710‏
996 ‎‡2 ISNI|0000000060169386‏
996 ‎‡2 BNE|XX1544753‏
996 ‎‡2 BNE|XX1044034‏
996 ‎‡2 BNCHL|10000000000000000238687‏
996 ‎‡2 BNE|XX1009657‏
996 ‎‡2 BNE|XX4977071‏
996 ‎‡2 LC|n 93040245‏
996 ‎‡2 LC|ns2023002744‏
996 ‎‡2 LC|n 2007042789‏
996 ‎‡2 SUDOC|131546643‏
996 ‎‡2 SUDOC|135756294‏
996 ‎‡2 BIBSYS|2110742‏
996 ‎‡2 NTA|428702953‏
997 ‎‡a 0 0 lived 0 0‏ ‎‡9 1‏
998 ‎‡a Sanchez‏ ‎‡b Jean-Charles‏ ‎‡2 BNF|14044044‏ ‎‡3 title: (0.73, 'proteomics', 'plateletproteomics')‏
998 ‎‡a Sanchez, Jean-Charles‏ ‎‡2 J9U|987007452415605171‏ ‎‡3 viafid‏
998 ‎‡a Sanchez, Jean-Charles‏ ‎‡2 BIBSYS|5000173‏ ‎‡3 viafid‏
998 ‎‡a Sanchez, Jean-Charles‏ ‎‡2 RERO|A003783451‏ ‎‡3 exact title: (1.00, '2dimensionalpolyacrylamidegelelectrophoresisisolationandmicrosequencingofpseudomonasaeruginosaproteins', '2dimensionalpolyacrylamidegelelectrophoresisisolationandmicrosequencingofpseudomonasaeruginosaproteins')‏