VIAF

Virtual International Authority File

Search

Leader 00000nz a2200037n 45 0
001 WKP|Q104490027 (VIAF cluster) (Authority/Source Record)
003 WKP
005 20241221010631.0
008 241221nneanz||abbn n and d
035 ‎‡a (WKP)Q104490027‏
024 ‎‡a 0000-0001-9665-9923‏ ‎‡2 orcid‏
035 ‎‡a (OCoLC)Q104490027‏
100 0 ‎‡a Adriano Antunes de Souza AraÚjo‏ ‎‡c researcher‏ ‎‡9 en‏
400 0 ‎‡a Adriano Antunes de Souza AraÚjo‏ ‎‡c onderzoeker‏ ‎‡9 nl‏
670 ‎‡a Author's A systematic review for anti-inflammatory property of clusiaceae family: a preclinical approach‏
670 ‎‡a Author's A systematic review of the wound-healing effects of monoterpenes and iridoid derivatives.‏
670 ‎‡a Author's Abarema cochliacarpos extract decreases the inflammatory process and skeletal muscle injury induced by Bothrops leucurus venom.‏
670 ‎‡a Author's Acute and sub-acute oral toxicity of Brazilian red propolis in rats‏
670 ‎‡a Author's Adenovirus vector-induced CD8⁺ T effector memory cell differentiation and recirculation, but not proliferation, are important for protective immunity against experimental Trypanosoma cruzi Infection‏
670 ‎‡a Author's Advances of nanosystems containing cyclodextrins and their applications in pharmaceuticals‏
670 ‎‡a Author's Alpha-terpineol complexed with beta-cyclodextrin reduces damages caused by periodontitis in rats‏
670 ‎‡a Author's Amorphous solid dispersions of hecogenin acetate using different polymers for enhancement of solubility and improvement of anti-hyperalgesic effect in neuropathic pain model in mice‏
670 ‎‡a Author's Analysis of Aloe vera cytotoxicity and genotoxicity associated with endodontic medication and laser photobiomodulation.‏
670 ‎‡a Author's Anti-hyperalgesic and anti-inflammatory effects of citral with β-cyclodextrin and hydroxypropyl-β-cyclodextrin inclusion complexes in animal models‏
670 ‎‡a Author's Anti-hyperalgesic effect of Lippia grata leaf essential oil complexed with β-cyclodextrin in a chronic musculoskeletal pain animal model: Complemented with a molecular docking and antioxidant screening.‏
670 ‎‡a Author's Anti-hyperalgesic effect of (-)-α-bisabolol and (-)-α-bisabolol/β-Cyclodextrin complex in a chronic inflammatory pain model is associated with reduced reactive gliosis and cytokine modulation‏
670 ‎‡a Author's Anti-Inflammatory Activity of Limonene in Prevention and Control of Injuries in the Respiratory System: A Systematic Review‏
670 ‎‡a Author's Anti-inflammatory and antioxidant activity of carvacrol in the respiratory system: A systematic review and meta-analysis‏
670 ‎‡a Author's Anti-Inflammatory and Physicochemical Characterization of the Croton Rhamnifolioides Essential Oil Inclusion Complex in β-Cyclodextrin‏
670 ‎‡a Author's Anti-inflammatory effect of nano-encapsulated nerolidol on zymosan-induced arthritis in mice‏
670 ‎‡a Author's Anticonvulsant, sedative, anxiolytic and antidepressant activities of the essential oil of Annona vepretorum in mice: Involvement of GABAergic and serotonergic systems‏
670 ‎‡a Author's Antidiarrheal activity of farnesol in rodents: Pharmacological actions and molecular docking‏
670 ‎‡a Author's Antihypertensive potential of linalool and linalool complexed with β-cyclodextrin: effects of subchronic treatment on blood pressure and vascular reactivity.‏
670 ‎‡a Author's Antinociceptive action and redox properties of citronellal, an essential oil present in lemongrass‏
670 ‎‡a Author's Antioxidant, Antinociceptive, and Anti-inflammatory Properties of the Ethanolic Extract of Combretum duarteanum in Rodents‏
670 ‎‡a Author's Bradycardic and Antiarrhythmic Effects of the D-Limonene in Rats‏
670 ‎‡a Author's Carvacrol suppresses LPS-induced pro-inflammatory activation in RAW 264.7 macrophages through ERK1/2 and NF-kB pathway‏
670 ‎‡a Author's Catastrophic Floods in Rio Grande do Sul, Brazil: The Need for Public Health Responses to Potential Infectious Disease Outbreaks‏
670 ‎‡a Author's Characterization of β-cyclodextrin/myrtenol complex and its protective effect against nociceptive behavior and cognitive impairment in a chronic musculoskeletal pain model‏
670 ‎‡a Author's ChatGPT: the new panacea of the academic world‏
670 ‎‡a Author's Citronellol, a natural acyclic monoterpene, attenuates mechanical hyperalgesia response in mice: Evidence of the spinal cord lamina I inhibition.‏
670 ‎‡a Author's Clinical Characteristics and Outcomes in Patients With COVID-2019 and Leprosy‏
670 ‎‡a Author's Comparative analysis of the antibacterial and drug-modulatory effect of d-limonene alone and complexed with β-cyclodextrin‏
670 ‎‡a Author's Coriandrum sativum Extract Prevents Alarm Substance-Induced Fear- and Anxiety-Like Responses in Adult Zebrafish‏
670 ‎‡a Author's COVID-19 fatality rates related to social inequality in Northeast Brazil: a neighborhood-level analysis‏
670 ‎‡a Author's Cyclodextrins improving the physicochemical and pharmacological properties of antidepressant drugs: a patent review‏
670 ‎‡a Author's Cyclodextrins: improving the therapeutic response of analgesic drugs: a patent review.‏
670 ‎‡a Author's Cytokines in the management of rotavirus infection: A systematic review of in vivo studies‏
670 ‎‡a Author's D-limonene exhibits superior antihyperalgesic effects in a β-cyclodextrin-complexed form in chronic musculoskeletal pain reducing Fos protein expression on spinal cord in mice.‏
670 ‎‡a Author's Delay in head and neck cancer care during the COVID-19 pandemic and its impact on health outcomes‏
670 ‎‡a Author's Determination of in vitro usnic acid delivery into porcine skin using a HPLC method‏
670 ‎‡a Author's Development of morin/hydroxypropyl-β-cyclodextrin inclusion complex: Enhancement of bioavailability, antihyperalgesic and anti-inflammatory effects‏
670 ‎‡a Author's Docking, characterization and investigation of β-cyclodextrin complexed with farnesol, an acyclic sesquiterpene alcohol, produces orofacial antinociceptive profile in experimental protocols‏
670 ‎‡a Author's Effect of α-Bisabolol and Its β-Cyclodextrin Complex as TetK and NorA Efflux Pump Inhibitors in Staphylococcus aureus Strains‏
670 ‎‡a Author's Effects of luteolin and quercetin 3-β-d-glucoside identified from Passiflora subpeltata leaves against acetaminophen induced hepatotoxicity in rats.‏
670 ‎‡a Author's Efficacy and safety of medicinal plants or related natural products for fibromyalgia: a systematic review‏
670 ‎‡a Author's Encapsulation of carvacrol, a monoterpene present in the essential oil of oregano, with β-cyclodextrin, improves the pharmacological response on cancer pain experimental protocols‏
670 ‎‡a Author's Enhanced analgesic activity by cyclodextrins - a systematic review and meta-analysis.‏
670 ‎‡a Author's Enhancement of orofacial antinociceptive effect of carvacrol, a monoterpene present in oregano and thyme oils, by β-cyclodextrin inclusion complex in mice‏
670 ‎‡a Author's Epidemiologic Study of Charcot-Marie-Tooth Disease: A Systematic Review‏
670 ‎‡a Author's Eplingiella fruticosa (Lamiaceae) essential oil complexed with β-cyclodextrin improves its anti-hyperalgesic effect in a chronic widespread non-inflammatory muscle pain animal model‏
670 ‎‡a Author's Evaluation instruments for physical therapy using virtual reality in stroke patients: a systematic review‏
670 ‎‡a Author's Evaluation of Aristolochia indica L. and Piper nigrum L. methanol extract against centipede Scolopendra moristans L. using Wistar albino rats and screening of bioactive compounds by high pressure liquid chromatography: a polyherbal formulation‏
670 ‎‡a Author's Evaluation of carvedilol compatibility with lipid excipients for the development of lipid-based drug delivery systems‏
670 ‎‡a Author's Evaluation of muscle strength, balance and functionality of individuals with type 2 Charcot-Marie-Tooth Disease‏
670 ‎‡a Author's Evaluation of Respiratory Muscle Strength and Pulmonary Function in Patients with Charcot-Marie-Tooth Disease Type 2.‏
670 ‎‡a Author's Evaluation of the antibacterial and modulatory potential of α-bisabolol, β-cyclodextrin and α-bisabolol/β-cyclodextrin complex.‏
670 ‎‡a Author's Evaluation of the Use of Compressive Stockings Impregnated With Hesperetin-Based Nanocapsules in the Healing of Venous Ulcers: A Case Report‏
670 ‎‡a Author's Factors Associated with Mortality among Hospitalized Patients with COVID-19: A Retrospective Cohort Study‏
670 ‎‡a Author's Flavonoids as Th1/Th2 cytokines immunomodulators: A systematic review of studies on animal models‏
670 ‎‡a Author's Gelatin-based membrane containing usnic acid-loaded liposome improves dermal burn healing in a porcine model.‏
670 ‎‡a Author's Gelatin-based membrane containing usnic acid-loaded liposomes: A new treatment strategy for corneal healing‏
670 ‎‡a Author's Hesperetin-loaded lipid-core nanocapsules in polyamide: a new textile formulation for topical drug delivery‏
670 ‎‡a Author's Host–guest inclusion complexation of β-cyclodextrin and hecogenin acetate to enhance anti-hyperalgesic effect in an animal model of musculoskeletal pain‏
670 ‎‡a Author's Hydroalcoholic extract of Brazilian red propolis exerts protective effects on acetic acid-induced ulcerative colitis in a rodent model.‏
670 ‎‡a Author's Improvement of p-cymene antinociceptive and anti-inflammatory effects by inclusion in β-cyclodextrin‏
670 ‎‡a Author's In Vitro Neuroprotective Effect of Shikimic Acid Against Hydrogen Peroxide-Induced Oxidative Stress‏
670 ‎‡a Author's Incidental finding of an ARCAPA during angiography‏
670 ‎‡a Author's Inclusion complex between β-cyclodextrin and hecogenin acetate produces superior analgesic effect in animal models for orofacial pain.‏
670 ‎‡a Author's Inclusion complex with β-cyclodextrin is a key determining factor for the cardioprotection induced by usnic acid‏
670 ‎‡a Author's Inclusion complex with β-cyclodextrin is a key determining factor for the cardioprotection induced by usnic acid‏
670 ‎‡a Author's Inclusion Complexes of Copaiba‏
670 ‎‡a Author's Inclusion Complexes of Copaiba (Copaifera multijuga Hayne) Oleoresin and Cyclodextrins: Physicochemical Characterization and Anti-Inflammatory Activity.‏
670 ‎‡a Author's Inflammatory Mediators and Oxidative Stress in Animals Subjected to Smoke Inhalation: A Systematic Review‏
670 ‎‡a Author's Inflammatory modulation of fluoxetine use in patients with depression: A systematic review and meta-analysis‏
670 ‎‡a Author's Involvement of the PKA pathway and inhibition of voltage gated Ca2+ channels in antihyperalgesic activity of Lippia grata/β-cyclodextrin‏
670 ‎‡a Author's (-)-linalool-Loaded Polymeric Nanocapsules Are a Potential Candidate to Fibromyalgia Treatment‏
670 ‎‡a Author's Mechanism of Action of Limonene in Tumor Cells: A Systematic Review and Metanalysis‏
670 ‎‡a Author's Medicinal plants and natural molecules with in vitro and in vivo activity against rotavirus: A systematic review.‏
670 ‎‡a Author's Microneedles as an alternative technology for transdermal drug delivery systems: a patent review‏
670 ‎‡a Author's Molecular mechanism underlying orofacial antinociceptive activity of Vanillosmopsis arborea Baker‏
670 ‎‡a Author's Molecular mechanism underlying orofacial antinociceptive activity of Vanillosmopsis arborea Baker (Asteraceae) essential oil complexed with β-cyclodextrin‏
670 ‎‡a Author's Molecular Modeling and Physicochemical Properties of Supramolecular Complexes of Limonene with α- and β-Cyclodextrins‏
670 ‎‡a Author's Morinda citrifolia and the pharmaceutical industry: technological prospecting and potential‏
670 ‎‡a Author's Morinda citrifolia Linn leaf extract possesses antioxidant activities and reduces nociceptive behavior and leukocyte migration‏
670 ‎‡a Author's Naringenin complexed with hydroxypropyl-β-cyclodextrin improves the sciatic nerve regeneration through inhibition of p75NTR and JNK pathway‏
670 ‎‡a Author's Natural and synthetic products used for the treatment of smoke inhalation: a patent review.‏
670 ‎‡a Author's Natural compounds for solar photoprotection: a patent review‏
670 ‎‡a Author's Nerolidol-beta-cyclodextrin inclusion complex enhances anti-inflammatory activity in arthritis model and improves gastric protection‏
670 ‎‡a Author's New drugs or alternative therapy to blurring the symptoms of fibromyalgia-a patent review.‏
670 ‎‡a Author's New therapeutic patents used for the treatment of leprosy: a review‏
670 ‎‡a Author's Otoliths-composed gelatin/sodium alginate scaffolds for bone regeneration‏
670 ‎‡a Author's Pharmaceutical agents for treatment of leishmaniasis: a patent landscape‏
670 ‎‡a Author's Pharmacologic Treatment of Vitiligo in Children and Adolescents: A Systematic Review‏
670 ‎‡a Author's Pharmacological Effects Of Carvacrol In Vitro Studies: A Review‏
670 ‎‡a Author's Pharmacological properties of lichen Cladonia clathrata‏
670 ‎‡a Author's Physico-chemical characterization and antibacterial activity of inclusion complexes of Hyptis martiusii Benth essential oil in β-cyclodextrin.‏
670 ‎‡a Author's Physicochemical Characterization and Antinociceptive Effect of β-cyclodextrin/Lippia pedunculosa Essential Oil in Mice‏
670 ‎‡a Author's Phytochemical profile and mechanisms involved in the anti-nociception caused by the hydroethanolic extract obtained from Tocoyena formosa‏
670 ‎‡a Author's Phytochemical profile and mechanisms involved in the anti-nociception caused by the hydroethanolic extract obtained from Tocoyena formosa (Cham. & Schltdl.) K. Schum (Jenipapo-bravo) leaves in mice.‏
670 ‎‡a Author's Polyphenols rich Passiflora leschenaultii leaves modulating Farnesoid X Receptor and Pregnane X Receptor against paracetamol-induced hepatotoxicity in rats‏
670 ‎‡a Author's Products with Natural Components to Heal Dermal Burns: A Patent Review‏
670 ‎‡a Author's Protective effects of flavonoid composition rich P. subpeltata Ortega. on indomethacin induced experimental ulcerative colitis in rat models of inflammatory bowel diseases‏
670 ‎‡a Author's Racial Disparities in COVID-19-related Deaths in Brazil: Black Lives Matter?‏
670 ‎‡a Author's Recent Patents on Medicinal Plants/Natural Products as a Therapeutic Approach to Wounds and Burns Healing.‏
670 ‎‡a Author's Redox properties and cytoprotective actions of atranorin, a lichen secondary metabolite‏
670 ‎‡a Author's Seroprevalence of SARS-CoV-2 IgM and IgG antibodies in an asymptomatic population in Sergipe, Brazil‏
670 ‎‡a Author's Shikimic acid inhibits LPS-induced cellular pro-inflammatory cytokines and attenuates mechanical hyperalgesia in mice.‏
670 ‎‡a Author's Structure–activity relationship of terpenes with anti-inflammatory profile – a systematic review‏
670 ‎‡a Author's Substâncias fitoquímicas para o controle do Aedes aegypti: protocolo de scoping review‏
670 ‎‡a Author's Synthetic drugs for the treatment of vitiligo: a patent review (2010-2015).‏
670 ‎‡a Author's The ethanol extract of Leonurus sibiricus L. induces antioxidant, antinociceptive and topical anti-inflammatory effects.‏
670 ‎‡a Author's The use of cyclodextrin inclusion complexes to improve anticancer drug profiles: a systematic review‏
670 ‎‡a Author's Therapeutic bullfrog oil-based nanoemulsion for oral application: Development, characterization and stability‏
670 ‎‡a Author's Treatment for chemical burning using liquid crystalline nanoparticles as an ophthalmic delivery system for pirfenidone‏
670 ‎‡a Author's UHPLC-QqQ-MS/MS identification, quantification of polyphenols from Passiflora subpeltata fruit pulp and determination of nutritional, antioxidant, α-amylase and α-glucosidase key enzymes inhibition properties‏
670 ‎‡a Author's Use of herbal medicines by elderly patients: A systematic review‏
670 ‎‡a Author's UVA-UVB photoprotective activity of topical formulations containing Morinda citrifolia extract‏
670 ‎‡a Author's Volatile profiling and UHPLC-QqQ-MS/MS polyphenol analysis of Passiflora leschenaultii DC. fruits and its anti-radical and anti-diabetic properties‏
670 ‎‡a Author's α-Terpineol, a monoterpene alcohol, complexed with β-cyclodextrin exerts antihyperalgesic effect in animal model for fibromyalgia aided with docking study‏
670 ‎‡a Author's β-caryophyllene, a dietary cannabinoid, complexed with β-cyclodextrin produced anti-hyperalgesic effect involving the inhibition of Fos expression in superficial dorsal horn‏
670 ‎‡a Author's β-cyclodextrin complex containing Lippia grata leaf essential oil reduces orofacial nociception in mice - evidence of possible involvement of descending inhibitory pain modulation pathway‏
909 ‎‡a (orcid) 0000000196659923‏ ‎‡9 1‏
919 ‎‡a inclusioncomplexwithβcyclodextrinisakeydeterminingfactorforthecardioprotectioninducedbyusnicacid‏ ‎‡A Inclusion complex with β-cyclodextrin is a key determining factor for the cardioprotection induced by usnic acid‏ ‎‡9 1‏
919 ‎‡a inclusioncomplexesofcopaibacopaiferamultijugahayneoleoresinandcyclodextrinsphysicochemicalcharacterizationandantiinflammatoryactivity‏ ‎‡A Inclusion Complexes of Copaiba (Copaifera multijuga Hayne) Oleoresin and Cyclodextrins: Physicochemical Characterization and Anti-Inflammatory Activity.‏ ‎‡9 1‏
919 ‎‡a inflammatorymediatorsandoxidativestressinanimalssubjectedtosmokeinhalationasystematicreview‏ ‎‡A Inflammatory Mediators and Oxidative Stress in Animals Subjected to Smoke Inhalation: A Systematic Review‏ ‎‡9 1‏
919 ‎‡a inflammatorymodulationoffluoxetineuseinpatientswithdepressionasystematicreviewandmetaanalysis‏ ‎‡A Inflammatory modulation of fluoxetine use in patients with depression: A systematic review and meta-analysis‏ ‎‡9 1‏
919 ‎‡a involvementofthepkapathwayandinhibitionofvoltagegatedca2+channelsinantihyperalgesicactivityoflippiagrataβcyclodextrin‏ ‎‡A Involvement of the PKA pathway and inhibition of voltage gated Ca2+ channels in antihyperalgesic activity of Lippia grata/β-cyclodextrin‏ ‎‡9 1‏
919 ‎‡a linaloolloadedpolymericnanocapsulesareapotentialcandidatetofibromyalgiatreatment‏ ‎‡A (-)-linalool-Loaded Polymeric Nanocapsules Are a Potential Candidate to Fibromyalgia Treatment‏ ‎‡9 1‏
919 ‎‡a mechanismofactionoflimoneneintumorcellsasystematicreviewandmetanalysis‏ ‎‡A Mechanism of Action of Limonene in Tumor Cells: A Systematic Review and Metanalysis‏ ‎‡9 1‏
919 ‎‡a medicinalplantsandnaturalmoleculeswithinvitroandinvivoactivityagainstrotavirusasystematicreview‏ ‎‡A Medicinal plants and natural molecules with in vitro and in vivo activity against rotavirus: A systematic review.‏ ‎‡9 1‏
919 ‎‡a microneedlesasanalternativetechnologyfortransdermaldrugdeliverysystemsapatentreview‏ ‎‡A Microneedles as an alternative technology for transdermal drug delivery systems: a patent review‏ ‎‡9 1‏
919 ‎‡a inclusioncomplexwithi2cyclodextrinisakeydeterminingfactorforthecardioprotectioninducedbyusnicacid‏ ‎‡A Inclusion complex with β-cyclodextrin is a key determining factor for the cardioprotection induced by usnic acid‏ ‎‡9 1‏
919 ‎‡a inclusioncomplexbetweenβcyclodextrinandhecogeninacetateproducessuperioranalgesiceffectinanimalmodelsfororofacialpain‏ ‎‡A Inclusion complex between β-cyclodextrin and hecogenin acetate produces superior analgesic effect in animal models for orofacial pain.‏ ‎‡9 1‏
919 ‎‡a incidentalfindingofanarcapaduringangiography‏ ‎‡A Incidental finding of an ARCAPA during angiography‏ ‎‡9 1‏
919 ‎‡a invitroneuroprotectiveeffectofshikimicacidagainsthydrogenperoxideinducedoxidativestress‏ ‎‡A In Vitro Neuroprotective Effect of Shikimic Acid Against Hydrogen Peroxide-Induced Oxidative Stress‏ ‎‡9 1‏
919 ‎‡a improvementofpcymeneantinociceptiveandantiinflammatoryeffectsbyinclusioninβcyclodextrin‏ ‎‡A Improvement of p-cymene antinociceptive and anti-inflammatory effects by inclusion in β-cyclodextrin‏ ‎‡9 1‏
919 ‎‡a hydroalcoholicextractofbrazilianredpropolisexertsprotectiveeffectsonaceticacidinducedulcerativecolitisinarodentmodel‏ ‎‡A Hydroalcoholic extract of Brazilian red propolis exerts protective effects on acetic acid-induced ulcerative colitis in a rodent model.‏ ‎‡9 1‏
919 ‎‡a hostguestinclusioncomplexationofβcyclodextrinandhecogeninacetatetoenhanceantihyperalgesiceffectinananimalmodelofmusculoskeletalpain‏ ‎‡A Host–guest inclusion complexation of β-cyclodextrin and hecogenin acetate to enhance anti-hyperalgesic effect in an animal model of musculoskeletal pain‏ ‎‡9 1‏
919 ‎‡a hesperetinloadedlipidcorenanocapsulesinpolyamideanewtextileformulationfortopicaldrugdelivery‏ ‎‡A Hesperetin-loaded lipid-core nanocapsules in polyamide: a new textile formulation for topical drug delivery‏ ‎‡9 1‏
919 ‎‡a gelatinbasedmembranecontainingusnicacidloadedliposomesanewtreatmentstrategyforcornealhealing‏ ‎‡A Gelatin-based membrane containing usnic acid-loaded liposomes: A new treatment strategy for corneal healing‏ ‎‡9 1‏
919 ‎‡a gelatinbasedmembranecontainingusnicacidloadedliposomeimprovesdermalburnhealinginaporcinemodel‏ ‎‡A Gelatin-based membrane containing usnic acid-loaded liposome improves dermal burn healing in a porcine model.‏ ‎‡9 1‏
919 ‎‡a flavonoidsasth1th2cytokinesimmunomodulatorsasystematicreviewofstudiesonanimalmodels‏ ‎‡A Flavonoids as Th1/Th2 cytokines immunomodulators: A systematic review of studies on animal models‏ ‎‡9 1‏
919 ‎‡a factorsassociatedwithmortalityamonghospitalizedpatientswithcovid19aretrospectivecohortstudy‏ ‎‡A Factors Associated with Mortality among Hospitalized Patients with COVID-19: A Retrospective Cohort Study‏ ‎‡9 1‏
919 ‎‡a evaluationoftheuseofcompressivestockingsimpregnatedwithhesperetinbasednanocapsulesinthehealingofvenousulcersacasereport‏ ‎‡A Evaluation of the Use of Compressive Stockings Impregnated With Hesperetin-Based Nanocapsules in the Healing of Venous Ulcers: A Case Report‏ ‎‡9 1‏
919 ‎‡a evaluationoftheantibacterialandmodulatorypotentialofαbisabololβcyclodextrinandαbisabololβcyclodextrincomplex‏ ‎‡A Evaluation of the antibacterial and modulatory potential of α-bisabolol, β-cyclodextrin and α-bisabolol/β-cyclodextrin complex.‏ ‎‡9 1‏
919 ‎‡a evaluationofrespiratorymusclestrengthandpulmonaryfunctioninpatientswithcharcotmarietoothdiseasetype2‏ ‎‡A Evaluation of Respiratory Muscle Strength and Pulmonary Function in Patients with Charcot-Marie-Tooth Disease Type 2.‏ ‎‡9 1‏
919 ‎‡a evaluationofmusclestrengthbalanceandfunctionalityofindividualswithtype2charcotmarietoothdisease‏ ‎‡A Evaluation of muscle strength, balance and functionality of individuals with type 2 Charcot-Marie-Tooth Disease‏ ‎‡9 1‏
919 ‎‡a evaluationofcarvedilolcompatibilitywithlipidexcipientsforthedevelopmentoflipidbaseddrugdeliverysystems‏ ‎‡A Evaluation of carvedilol compatibility with lipid excipients for the development of lipid-based drug delivery systems‏ ‎‡9 1‏
919 ‎‡a evaluationofaristolochiaindica50andpipernigrum50methanolextractagainstcentipedescolopendramoristans50usingwistaralbinoratsandscreeningofbioactivecompoundsbyhighpressureliquidchromatographyapolyherbalformulation‏ ‎‡A Evaluation of Aristolochia indica L. and Piper nigrum L. methanol extract against centipede Scolopendra moristans L. using Wistar albino rats and screening of bioactive compounds by high pressure liquid chromatography: a polyherbal formulation‏ ‎‡9 1‏
919 ‎‡a evaluationinstrumentsforphysicaltherapyusingvirtualrealityinstrokepatientsasystematicreview‏ ‎‡A Evaluation instruments for physical therapy using virtual reality in stroke patients: a systematic review‏ ‎‡9 1‏
919 ‎‡a eplingiellafruticosalamiaceaeessentialoilcomplexedwithβcyclodextrinimprovesitsantihyperalgesiceffectinachronicwidespreadnoninflammatorymusclepainanimalmodel‏ ‎‡A Eplingiella fruticosa (Lamiaceae) essential oil complexed with β-cyclodextrin improves its anti-hyperalgesic effect in a chronic widespread non-inflammatory muscle pain animal model‏ ‎‡9 1‏
919 ‎‡a epidemiologicstudyofcharcotmarietoothdiseaseasystematicreview‏ ‎‡A Epidemiologic Study of Charcot-Marie-Tooth Disease: A Systematic Review‏ ‎‡9 1‏
919 ‎‡a molecularmechanismunderlyingorofacialantinociceptiveactivityofvanillosmopsisarboreabaker‏ ‎‡A Molecular mechanism underlying orofacial antinociceptive activity of Vanillosmopsis arborea Baker‏ ‎‡9 1‏
919 ‎‡a molecularmechanismunderlyingorofacialantinociceptiveactivityofvanillosmopsisarboreabakerasteraceaeessentialoilcomplexedwithβcyclodextrin‏ ‎‡A Molecular mechanism underlying orofacial antinociceptive activity of Vanillosmopsis arborea Baker (Asteraceae) essential oil complexed with β-cyclodextrin‏ ‎‡9 1‏
919 ‎‡a molecularmodelingandphysicochemicalpropertiesofsupramolecularcomplexesoflimonenewithαandβcyclodextrins‏ ‎‡A Molecular Modeling and Physicochemical Properties of Supramolecular Complexes of Limonene with α- and β-Cyclodextrins‏ ‎‡9 1‏
919 ‎‡a morindacitrifoliaandthepharmaceuticalindustrytechnologicalprospectingandpotential‏ ‎‡A Morinda citrifolia and the pharmaceutical industry: technological prospecting and potential‏ ‎‡9 1‏
919 ‎‡a morindacitrifolialinnleafextractpossessesantioxidantactivitiesandreducesnociceptivebehaviorandleukocytemigration‏ ‎‡A Morinda citrifolia Linn leaf extract possesses antioxidant activities and reduces nociceptive behavior and leukocyte migration‏ ‎‡9 1‏
919 ‎‡a naringenincomplexedwithhydroxypropylβcyclodextrinimprovesthesciaticnerveregenerationthroughinhibitionofp75ntrandjnkpathway‏ ‎‡A Naringenin complexed with hydroxypropyl-β-cyclodextrin improves the sciatic nerve regeneration through inhibition of p75NTR and JNK pathway‏ ‎‡9 1‏
919 ‎‡a naturalandsyntheticproductsusedforthetreatmentofsmokeinhalationapatentreview‏ ‎‡A Natural and synthetic products used for the treatment of smoke inhalation: a patent review.‏ ‎‡9 1‏
919 ‎‡a naturalcompoundsforsolarphotoprotectionapatentreview‏ ‎‡A Natural compounds for solar photoprotection: a patent review‏ ‎‡9 1‏
919 ‎‡a nerolidolbetacyclodextrininclusioncomplexenhancesantiinflammatoryactivityinarthritismodelandimprovesgastricprotection‏ ‎‡A Nerolidol-beta-cyclodextrin inclusion complex enhances anti-inflammatory activity in arthritis model and improves gastric protection‏ ‎‡9 1‏
919 ‎‡a newdrugsoralternativetherapytoblurringthesymptomsoffibromyalgiaapatentreview‏ ‎‡A New drugs or alternative therapy to blurring the symptoms of fibromyalgia-a patent review.‏ ‎‡9 1‏
919 ‎‡a newtherapeuticpatentsusedforthetreatmentofleprosyareview‏ ‎‡A New therapeutic patents used for the treatment of leprosy: a review‏ ‎‡9 1‏
919 ‎‡a otolithscomposedgelatinsodiumalginatescaffoldsforboneregeneration‏ ‎‡A Otoliths-composed gelatin/sodium alginate scaffolds for bone regeneration‏ ‎‡9 1‏
919 ‎‡a pharmaceuticalagentsfortreatmentofleishmaniasisapatentlandscape‏ ‎‡A Pharmaceutical agents for treatment of leishmaniasis: a patent landscape‏ ‎‡9 1‏
919 ‎‡a pharmacologictreatmentofvitiligoinchildrenandadolescentsasystematicreview‏ ‎‡A Pharmacologic Treatment of Vitiligo in Children and Adolescents: A Systematic Review‏ ‎‡9 1‏
919 ‎‡a pharmacologicaleffectsofcarvacrolinvitrostudiesareview‏ ‎‡A Pharmacological Effects Of Carvacrol In Vitro Studies: A Review‏ ‎‡9 1‏
919 ‎‡a pharmacologicalpropertiesoflichencladoniaclathrata‏ ‎‡A Pharmacological properties of lichen Cladonia clathrata‏ ‎‡9 1‏
919 ‎‡a physicochemicalcharacterizationandantibacterialactivityofinclusioncomplexesofhyptismartiusiibenthessentialoilinβcyclodextrin‏ ‎‡A Physico-chemical characterization and antibacterial activity of inclusion complexes of Hyptis martiusii Benth essential oil in β-cyclodextrin.‏ ‎‡9 1‏
919 ‎‡a physicochemicalcharacterizationandantinociceptiveeffectofβcyclodextrinlippiapedunculosaessentialoilinmice‏ ‎‡A Physicochemical Characterization and Antinociceptive Effect of β-cyclodextrin/Lippia pedunculosa Essential Oil in Mice‏ ‎‡9 1‏
919 ‎‡a phytochemicalprofileandmechanismsinvolvedintheantinociceptioncausedbythehydroethanolicextractobtainedfromtocoyenaformosa‏ ‎‡A Phytochemical profile and mechanisms involved in the anti-nociception caused by the hydroethanolic extract obtained from Tocoyena formosa‏ ‎‡9 1‏
919 ‎‡a phytochemicalprofileandmechanismsinvolvedintheantinociceptioncausedbythehydroethanolicextractobtainedfromtocoyenaformosachamandschltdlkschumjenipapobravoleavesinmice‏ ‎‡A Phytochemical profile and mechanisms involved in the anti-nociception caused by the hydroethanolic extract obtained from Tocoyena formosa (Cham. & Schltdl.) K. Schum (Jenipapo-bravo) leaves in mice.‏ ‎‡9 1‏
919 ‎‡a polyphenolsrichpassifloraleschenaultiileavesmodulatingfarnesoid10receptorandpregnane10receptoragainstparacetamolinducedhepatotoxicityinrats‏ ‎‡A Polyphenols rich Passiflora leschenaultii leaves modulating Farnesoid X Receptor and Pregnane X Receptor against paracetamol-induced hepatotoxicity in rats‏ ‎‡9 1‏
919 ‎‡a productswithnaturalcomponentstohealdermalburnsapatentreview‏ ‎‡A Products with Natural Components to Heal Dermal Burns: A Patent Review‏ ‎‡9 1‏
919 ‎‡a protectiveeffectsofflavonoidcompositionrichpsubpeltataortegaonindomethacininducedexperimentalulcerativecolitisinratmodelsofinflammatoryboweldiseases‏ ‎‡A Protective effects of flavonoid composition rich P. subpeltata Ortega. on indomethacin induced experimental ulcerative colitis in rat models of inflammatory bowel diseases‏ ‎‡9 1‏
919 ‎‡a racialdisparitiesincovid19relateddeathsinbrazilblacklivesmatter‏ ‎‡A Racial Disparities in COVID-19-related Deaths in Brazil: Black Lives Matter?‏ ‎‡9 1‏
919 ‎‡a recentpatentsonmedicinalplantsnaturalproductsasatherapeuticapproachtowoundsandburnshealing‏ ‎‡A Recent Patents on Medicinal Plants/Natural Products as a Therapeutic Approach to Wounds and Burns Healing.‏ ‎‡9 1‏
919 ‎‡a redoxpropertiesandcytoprotectiveactionsofatranorinalichensecondarymetabolite‏ ‎‡A Redox properties and cytoprotective actions of atranorin, a lichen secondary metabolite‏ ‎‡9 1‏
919 ‎‡a seroprevalenceofsarscov2igmandiggantibodiesinanasymptomaticpopulationinsergipebrazil‏ ‎‡A Seroprevalence of SARS-CoV-2 IgM and IgG antibodies in an asymptomatic population in Sergipe, Brazil‏ ‎‡9 1‏
919 ‎‡a shikimicacidinhibitslpsinducedcellularproinflammatorycytokinesandattenuatesmechanicalhyperalgesiainmice‏ ‎‡A Shikimic acid inhibits LPS-induced cellular pro-inflammatory cytokines and attenuates mechanical hyperalgesia in mice.‏ ‎‡9 1‏
919 ‎‡a structureactivityrelationshipofterpeneswithantiinflammatoryprofileasystematicreview‏ ‎‡A Structure–activity relationship of terpenes with anti-inflammatory profile – a systematic review‏ ‎‡9 1‏
919 ‎‡a substanciasfitoquimicasparaocontroledoaedesaegyptiprotocolodescopingreview‏ ‎‡A Substâncias fitoquímicas para o controle do Aedes aegypti: protocolo de scoping review‏ ‎‡9 1‏
919 ‎‡a syntheticdrugsforthetreatmentofvitiligoapatentreview2010‏ ‎‡A Synthetic drugs for the treatment of vitiligo: a patent review (2010-2015).‏ ‎‡9 1‏
919 ‎‡a ethanolextractofleonurussibiricus50inducesantioxidantantinociceptiveandtopicalantiinflammatoryeffects‏ ‎‡A The ethanol extract of Leonurus sibiricus L. induces antioxidant, antinociceptive and topical anti-inflammatory effects.‏ ‎‡9 1‏
919 ‎‡a useofcyclodextrininclusioncomplexestoimproveanticancerdrugprofilesasystematicreview‏ ‎‡A The use of cyclodextrin inclusion complexes to improve anticancer drug profiles: a systematic review‏ ‎‡9 1‏
919 ‎‡a therapeuticbullfrogoilbasednanoemulsionfororalapplicationdevelopmentcharacterizationandstability‏ ‎‡A Therapeutic bullfrog oil-based nanoemulsion for oral application: Development, characterization and stability‏ ‎‡9 1‏
919 ‎‡a treatmentforchemicalburningusingliquidcrystallinenanoparticlesasanophthalmicdeliverysystemforpirfenidone‏ ‎‡A Treatment for chemical burning using liquid crystalline nanoparticles as an ophthalmic delivery system for pirfenidone‏ ‎‡9 1‏
919 ‎‡a uhplcqqqmsmsidentificationquantificationofpolyphenolsfrompassiflorasubpeltatafruitpulpanddeterminationofnutritionalantioxidantαamylaseandαglucosidasekeyenzymesinhibitionproperties‏ ‎‡A UHPLC-QqQ-MS/MS identification, quantification of polyphenols from Passiflora subpeltata fruit pulp and determination of nutritional, antioxidant, α-amylase and α-glucosidase key enzymes inhibition properties‏ ‎‡9 1‏
919 ‎‡a useofherbalmedicinesbyelderlypatientsasystematicreview‏ ‎‡A Use of herbal medicines by elderly patients: A systematic review‏ ‎‡9 1‏
919 ‎‡a uvauvbphotoprotectiveactivityoftopicalformulationscontainingmorindacitrifoliaextract‏ ‎‡A UVA-UVB photoprotective activity of topical formulations containing Morinda citrifolia extract‏ ‎‡9 1‏
919 ‎‡a volatileprofilinganduhplcqqqmsmspolyphenolanalysisofpassifloraleschenaultii600fruitsanditsantiradicalandantidiabeticproperties‏ ‎‡A Volatile profiling and UHPLC-QqQ-MS/MS polyphenol analysis of Passiflora leschenaultii DC. fruits and its anti-radical and anti-diabetic properties‏ ‎‡9 1‏
919 ‎‡a αterpineolamonoterpenealcoholcomplexedwithβcyclodextrinexertsantihyperalgesiceffectinanimalmodelforfibromyalgiaaidedwithdockingstudy‏ ‎‡A α-Terpineol, a monoterpene alcohol, complexed with β-cyclodextrin exerts antihyperalgesic effect in animal model for fibromyalgia aided with docking study‏ ‎‡9 1‏
919 ‎‡a βcaryophylleneadietarycannabinoidcomplexedwithβcyclodextrinproducedantihyperalgesiceffectinvolvingtheinhibitionoffosexpressioninsuperficialdorsalhorn‏ ‎‡A β-caryophyllene, a dietary cannabinoid, complexed with β-cyclodextrin produced anti-hyperalgesic effect involving the inhibition of Fos expression in superficial dorsal horn‏ ‎‡9 1‏
919 ‎‡a βcyclodextrincomplexcontaininglippiagrataleafessentialoilreducesorofacialnociceptioninmiceevidenceofpossibleinvolvementofdescendinginhibitorypainmodulationpathway‏ ‎‡A β-cyclodextrin complex containing Lippia grata leaf essential oil reduces orofacial nociception in mice - evidence of possible involvement of descending inhibitory pain modulation pathway‏ ‎‡9 1‏
919 ‎‡a enhancementoforofacialantinociceptiveeffectofcarvacrolamonoterpenepresentinoreganoandthymeoilsbyβcyclodextrininclusioncomplexinmice‏ ‎‡A Enhancement of orofacial antinociceptive effect of carvacrol, a monoterpene present in oregano and thyme oils, by β-cyclodextrin inclusion complex in mice‏ ‎‡9 1‏
919 ‎‡a enhancedanalgesicactivitybycyclodextrinsasystematicreviewandmetaanalysis‏ ‎‡A Enhanced analgesic activity by cyclodextrins - a systematic review and meta-analysis.‏ ‎‡9 1‏
919 ‎‡a encapsulationofcarvacrolamonoterpenepresentintheessentialoiloforeganowithβcyclodextrinimprovesthepharmacologicalresponseoncancerpainexperimentalprotocols‏ ‎‡A Encapsulation of carvacrol, a monoterpene present in the essential oil of oregano, with β-cyclodextrin, improves the pharmacological response on cancer pain experimental protocols‏ ‎‡9 1‏
919 ‎‡a efficacyandsafetyofmedicinalplantsorrelatednaturalproductsforfibromyalgiaasystematicreview‏ ‎‡A Efficacy and safety of medicinal plants or related natural products for fibromyalgia: a systematic review‏ ‎‡9 1‏
919 ‎‡a effectsofluteolinandquercetin3β500glucosideidentifiedfrompassiflorasubpeltataleavesagainstacetaminopheninducedhepatotoxicityinrats‏ ‎‡A Effects of luteolin and quercetin 3-β-d-glucoside identified from Passiflora subpeltata leaves against acetaminophen induced hepatotoxicity in rats.‏ ‎‡9 1‏
919 ‎‡a effectofαbisabololanditsβcyclodextrincomplexastetkandnoraeffluxpumpinhibitorsinstaphylococcusaureusstrains‏ ‎‡A Effect of α-Bisabolol and Its β-Cyclodextrin Complex as TetK and NorA Efflux Pump Inhibitors in Staphylococcus aureus Strains‏ ‎‡9 1‏
919 ‎‡a dockingcharacterizationandinvestigationofβcyclodextrincomplexedwithfarnesolanacyclicsesquiterpenealcoholproducesorofacialantinociceptiveprofileinexperimentalprotocols‏ ‎‡A Docking, characterization and investigation of β-cyclodextrin complexed with farnesol, an acyclic sesquiterpene alcohol, produces orofacial antinociceptive profile in experimental protocols‏ ‎‡9 1‏
919 ‎‡a developmentofmorinhydroxypropylβcyclodextrininclusioncomplexenhancementofbioavailabilityantihyperalgesicandantiinflammatoryeffects‏ ‎‡A Development of morin/hydroxypropyl-β-cyclodextrin inclusion complex: Enhancement of bioavailability, antihyperalgesic and anti-inflammatory effects‏ ‎‡9 1‏
919 ‎‡a determinationofinvitrousnicaciddeliveryintoporcineskinusingahplcmethod‏ ‎‡A Determination of in vitro usnic acid delivery into porcine skin using a HPLC method‏ ‎‡9 1‏
919 ‎‡a delayinheadandneckcancercareduringthecovid19pandemicanditsimpactonhealthoutcomes‏ ‎‡A Delay in head and neck cancer care during the COVID-19 pandemic and its impact on health outcomes‏ ‎‡9 1‏
919 ‎‡a 500limoneneexhibitssuperiorantihyperalgesiceffectsinaβcyclodextrincomplexedforminchronicmusculoskeletalpainreducingfosproteinexpressiononspinalcordinmice‏ ‎‡A D-limonene exhibits superior antihyperalgesic effects in a β-cyclodextrin-complexed form in chronic musculoskeletal pain reducing Fos protein expression on spinal cord in mice.‏ ‎‡9 1‏
919 ‎‡a cytokinesinthemanagementofrotavirusinfectionasystematicreviewofinvivostudies‏ ‎‡A Cytokines in the management of rotavirus infection: A systematic review of in vivo studies‏ ‎‡9 1‏
919 ‎‡a cyclodextrinsimprovingthetherapeuticresponseofanalgesicdrugsapatentreview‏ ‎‡A Cyclodextrins: improving the therapeutic response of analgesic drugs: a patent review.‏ ‎‡9 1‏
919 ‎‡a cyclodextrinsimprovingthephysicochemicalandpharmacologicalpropertiesofantidepressantdrugsapatentreview‏ ‎‡A Cyclodextrins improving the physicochemical and pharmacological properties of antidepressant drugs: a patent review‏ ‎‡9 1‏
919 ‎‡a covid19fatalityratesrelatedtosocialinequalityinnortheastbrazilaneighborhoodlevelanalysis‏ ‎‡A COVID-19 fatality rates related to social inequality in Northeast Brazil: a neighborhood-level analysis‏ ‎‡9 1‏
919 ‎‡a coriandrumsativumextractpreventsalarmsubstanceinducedfearandanxietylikeresponsesinadultzebrafish‏ ‎‡A Coriandrum sativum Extract Prevents Alarm Substance-Induced Fear- and Anxiety-Like Responses in Adult Zebrafish‏ ‎‡9 1‏
919 ‎‡a comparativeanalysisoftheantibacterialanddrugmodulatoryeffectof500limonenealoneandcomplexedwithβcyclodextrin‏ ‎‡A Comparative analysis of the antibacterial and drug-modulatory effect of d-limonene alone and complexed with β-cyclodextrin‏ ‎‡9 1‏
919 ‎‡a clinicalcharacteristicsandoutcomesinpatientswithcovid2019andleprosy‏ ‎‡A Clinical Characteristics and Outcomes in Patients With COVID-2019 and Leprosy‏ ‎‡9 1‏
919 ‎‡a citronellolanaturalacyclicmonoterpeneattenuatesmechanicalhyperalgesiaresponseinmiceevidenceofthespinalcordlamina1inhibition‏ ‎‡A Citronellol, a natural acyclic monoterpene, attenuates mechanical hyperalgesia response in mice: Evidence of the spinal cord lamina I inhibition.‏ ‎‡9 1‏
919 ‎‡a chatgptthenewpanaceaoftheacademicworld‏ ‎‡A ChatGPT: the new panacea of the academic world‏ ‎‡9 1‏
919 ‎‡a characterizationofβcyclodextrinmyrtenolcomplexanditsprotectiveeffectagainstnociceptivebehaviorandcognitiveimpairmentinachronicmusculoskeletalpainmodel‏ ‎‡A Characterization of β-cyclodextrin/myrtenol complex and its protective effect against nociceptive behavior and cognitive impairment in a chronic musculoskeletal pain model‏ ‎‡9 1‏
919 ‎‡a catastrophicfloodsinriograndedosulbraziltheneedforpublichealthresponsestopotentialinfectiousdiseaseoutbreaks‏ ‎‡A Catastrophic Floods in Rio Grande do Sul, Brazil: The Need for Public Health Responses to Potential Infectious Disease Outbreaks‏ ‎‡9 1‏
919 ‎‡a carvacrolsuppresseslpsinducedproinflammatoryactivationinraw2647macrophagesthrougherk12andnfkbpathway‏ ‎‡A Carvacrol suppresses LPS-induced pro-inflammatory activation in RAW 264.7 macrophages through ERK1/2 and NF-kB pathway‏ ‎‡9 1‏
919 ‎‡a bradycardicandantiarrhythmiceffectsofthe500limoneneinrats‏ ‎‡A Bradycardic and Antiarrhythmic Effects of the D-Limonene in Rats‏ ‎‡9 1‏
919 ‎‡a antioxidantantinociceptiveandantiinflammatorypropertiesoftheethanolicextractofcombretumduarteanuminrodents‏ ‎‡A Antioxidant, Antinociceptive, and Anti-inflammatory Properties of the Ethanolic Extract of Combretum duarteanum in Rodents‏ ‎‡9 1‏
919 ‎‡a antinociceptiveactionandredoxpropertiesofcitronellalanessentialoilpresentinlemongrass‏ ‎‡A Antinociceptive action and redox properties of citronellal, an essential oil present in lemongrass‏ ‎‡9 1‏
919 ‎‡a antihypertensivepotentialoflinaloolandlinaloolcomplexedwithβcyclodextrineffectsofsubchronictreatmentonbloodpressureandvascularreactivity‏ ‎‡A Antihypertensive potential of linalool and linalool complexed with β-cyclodextrin: effects of subchronic treatment on blood pressure and vascular reactivity.‏ ‎‡9 1‏
919 ‎‡a antidiarrhealactivityoffarnesolinrodentspharmacologicalactionsandmoleculardocking‏ ‎‡A Antidiarrheal activity of farnesol in rodents: Pharmacological actions and molecular docking‏ ‎‡9 1‏
919 ‎‡a anticonvulsantsedativeanxiolyticandantidepressantactivitiesoftheessentialoilofannonavepretoruminmiceinvolvementofgabaergicandserotonergicsystems‏ ‎‡A Anticonvulsant, sedative, anxiolytic and antidepressant activities of the essential oil of Annona vepretorum in mice: Involvement of GABAergic and serotonergic systems‏ ‎‡9 1‏
919 ‎‡a antiinflammatoryeffectofnanoencapsulatednerolidolonzymosaninducedarthritisinmice‏ ‎‡A Anti-inflammatory effect of nano-encapsulated nerolidol on zymosan-induced arthritis in mice‏ ‎‡9 1‏
919 ‎‡a antiinflammatoryandphysicochemicalcharacterizationofthecrotonrhamnifolioidesessentialoilinclusioncomplexinβcyclodextrin‏ ‎‡A Anti-Inflammatory and Physicochemical Characterization of the Croton Rhamnifolioides Essential Oil Inclusion Complex in β-Cyclodextrin‏ ‎‡9 1‏
919 ‎‡a antiinflammatoryandantioxidantactivityofcarvacrolintherespiratorysystemasystematicreviewandmetaanalysis‏ ‎‡A Anti-inflammatory and antioxidant activity of carvacrol in the respiratory system: A systematic review and meta-analysis‏ ‎‡9 1‏
919 ‎‡a antiinflammatoryactivityoflimoneneinpreventionandcontrolofinjuriesintherespiratorysystemasystematicreview‏ ‎‡A Anti-Inflammatory Activity of Limonene in Prevention and Control of Injuries in the Respiratory System: A Systematic Review‏ ‎‡9 1‏
919 ‎‡a antihyperalgesiceffectofαbisabololandαbisabololβcyclodextrincomplexinachronicinflammatorypainmodelisassociatedwithreducedreactivegliosisandcytokinemodulation‏ ‎‡A Anti-hyperalgesic effect of (-)-α-bisabolol and (-)-α-bisabolol/β-Cyclodextrin complex in a chronic inflammatory pain model is associated with reduced reactive gliosis and cytokine modulation‏ ‎‡9 1‏
919 ‎‡a antihyperalgesiceffectoflippiagrataleafessentialoilcomplexedwithβcyclodextrininachronicmusculoskeletalpainanimalmodelcomplementedwithamoleculardockingandantioxidantscreening‏ ‎‡A Anti-hyperalgesic effect of Lippia grata leaf essential oil complexed with β-cyclodextrin in a chronic musculoskeletal pain animal model: Complemented with a molecular docking and antioxidant screening.‏ ‎‡9 1‏
919 ‎‡a antihyperalgesicandantiinflammatoryeffectsofcitralwithβcyclodextrinandhydroxypropylβcyclodextrininclusioncomplexesinanimalmodels‏ ‎‡A Anti-hyperalgesic and anti-inflammatory effects of citral with β-cyclodextrin and hydroxypropyl-β-cyclodextrin inclusion complexes in animal models‏ ‎‡9 1‏
919 ‎‡a analysisofaloeveracytotoxicityandgenotoxicityassociatedwithendodonticmedicationandlaserphotobiomodulation‏ ‎‡A Analysis of Aloe vera cytotoxicity and genotoxicity associated with endodontic medication and laser photobiomodulation.‏ ‎‡9 1‏
919 ‎‡a amorphoussoliddispersionsofhecogeninacetateusingdifferentpolymersforenhancementofsolubilityandimprovementofantihyperalgesiceffectinneuropathicpainmodelinmice‏ ‎‡A Amorphous solid dispersions of hecogenin acetate using different polymers for enhancement of solubility and improvement of anti-hyperalgesic effect in neuropathic pain model in mice‏ ‎‡9 1‏
919 ‎‡a Alpha terpineolcomplexedwithbetacyclodextrinreducesdamagescausedbyperiodontitisinrats‏ ‎‡A Alpha-terpineol complexed with beta-cyclodextrin reduces damages caused by periodontitis in rats‏ ‎‡9 1‏
919 ‎‡a advancesofnanosystemscontainingcyclodextrinsandtheirapplicationsinpharmaceuticals‏ ‎‡A Advances of nanosystems containing cyclodextrins and their applications in pharmaceuticals‏ ‎‡9 1‏
919 ‎‡a adenovirusvectorinducedcd8+teffectormemorycelldifferentiationandrecirculationbutnotproliferationareimportantforprotectiveimmunityagainstexperimentaltrypanosomacruziinfection‏ ‎‡A Adenovirus vector-induced CD8⁺ T effector memory cell differentiation and recirculation, but not proliferation, are important for protective immunity against experimental Trypanosoma cruzi Infection‏ ‎‡9 1‏
919 ‎‡a acuteandsubacuteoraltoxicityofbrazilianredpropolisinrats‏ ‎‡A Acute and sub-acute oral toxicity of Brazilian red propolis in rats‏ ‎‡9 1‏
919 ‎‡a abaremacochliacarposextractdecreasestheinflammatoryprocessandskeletalmuscleinjuryinducedbybothropsleucurusvenom‏ ‎‡A Abarema cochliacarpos extract decreases the inflammatory process and skeletal muscle injury induced by Bothrops leucurus venom.‏ ‎‡9 1‏
919 ‎‡a systematicreviewofthewoundhealingeffectsofmonoterpenesandiridoidderivatives‏ ‎‡A A systematic review of the wound-healing effects of monoterpenes and iridoid derivatives.‏ ‎‡9 1‏
919 ‎‡a systematicreviewforantiinflammatorypropertyofclusiaceaefamilyapreclinicalapproach‏ ‎‡A A systematic review for anti-inflammatory property of clusiaceae family: a preclinical approach‏ ‎‡9 1‏
919 ‎‡a inclusioncomplexesofcopaiba‏ ‎‡A Inclusion Complexes of Copaiba‏ ‎‡9 1‏
943 ‎‡a 201x‏ ‎‡A 2015‏ ‎‡9 1‏
996 ‎‡2 ISNI|0000000068615176
996 ‎‡2 ISNI|0000000083324326
996 ‎‡2 SELIBR|332480
996 ‎‡2 ISNI|0000000120780364
996 ‎‡2 BLBNB|000537014
996 ‎‡2 PTBNP|193036
996 ‎‡2 ISNI|0000000045498755
996 ‎‡2 RERO|A009069244
996 ‎‡2 ISNI|0000000119855357
996 ‎‡2 BLBNB|001134975
996 ‎‡2 BLBNB|001427389
996 ‎‡2 BNCHL|10000000000000000146891
996 ‎‡2 BLBNB|001277186
996 ‎‡2 J9U|987007314181905171
996 ‎‡2 ISNI|0000000069703119
996 ‎‡2 BIBSYS|6092651
996 ‎‡2 BNE|XX1714175
996 ‎‡2 ISNI|0000000391123534
996 ‎‡2 PTBNP|162638
996 ‎‡2 PTBNP|172219
996 ‎‡2 NTA|323247091
996 ‎‡2 BLBNB|000600320
996 ‎‡2 ISNI|0000000385314916
996 ‎‡2 PTBNP|1204569
996 ‎‡2 ISNI|0000000084850037
996 ‎‡2 PTBNP|111705
996 ‎‡2 ISNI|0000000069322041
996 ‎‡2 ISNI|0000000070112738
996 ‎‡2 ISNI|0000000059736822
996 ‎‡2 ISNI|0000000070504010
996 ‎‡2 LC|n 85007809
996 ‎‡2 LC|nb2016008961
996 ‎‡2 PLWABN|9810579719405606
996 ‎‡2 PTBNP|135989
996 ‎‡2 NII|DA14625594
996 ‎‡2 LC|no2016023369
996 ‎‡2 PTBNP|6296
996 ‎‡2 LC|n 2024255968
996 ‎‡2 ISNI|0000000069105637
996 ‎‡2 PTBNP|6293
996 ‎‡2 ISNI|0000000062701401
996 ‎‡2 LC|nr 95042851
996 ‎‡2 SUDOC|109435885
996 ‎‡2 BNE|XX1441096
997 ‎‡a 0 0 lived 0 0‏ ‎‡9 1‏